[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA57138.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------5--------------1--------1---1--1---122-1-----1---------1------1-2---------------------------------------------------------------1------------------------------1-11------1--11--------------------------------1-11--1111--------11-1--2---------1--------1------------------------1-11----21--------------111-111---11---1--------------------------1-211---1-------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTAPDESAQVHGISRVDVTHIHHYSRNPRRQQNPEYDRIKASIRAEGLDQPLVLSQEPGT:Sequence :ccc cccccEEEEEEEGGGEEcc ccccccHHHHHHHHHHHHHcGGGcccEEEEcTTc:Sec Str : ================================================:RP:SCP|13->207|1vk1A|8e-15|12.4|185/232|d.268.1.2 : ==========================:BL:SWS|35->197|REPB_AGRRH|2e-04|27.9|140/100 61: . . . * . .: 120 :SDYVLHSGGNTRLKILKDLFEETGDDRFRWVNCVIKPWSQESNLLFAHLRENELRGALPF:Sequence :cEEEEccccHHHHHHHHHTTccE EEEEEEEEcHHHHHHHGGGccc :Sec Str :============================================================:RP:SCP|13->207|1vk1A|8e-15|12.4|185/232|d.268.1.2 :============================================================:BL:SWS|35->197|REPB_AGRRH|2e-04|27.9|140/100 121: . . + . . .: 180 :IDKALAVFDAKALLEKELAVETLSQRQLEELFRERGFGLSHSMISKMGYAVDTLWPVMPK:Sequence : :Sec Str :============================================================:RP:SCP|13->207|1vk1A|8e-15|12.4|185/232|d.268.1.2 :============================================================:BL:SWS|35->197|REPB_AGRRH|2e-04|27.9|140/100 181: . * . . . .: 240 :ALAAGLGRPQVEKIRALERAAREIWDRRQLGEDMDFNAVFLELCRRHDCSEWDIQPLRDA:Sequence : :Sec Str :=========================== :RP:SCP|13->207|1vk1A|8e-15|12.4|185/232|d.268.1.2 :================= :BL:SWS|35->197|REPB_AGRRH|2e-04|27.9|140/100 241: + . . . . *: 300 :LENEIADESEQNRQVVYLEMEAQLSGRPFDFVSQPVEGEEEEQGGTSDKVCRQEKNQSAD:Sequence : :Sec Str : XXXXXXXXX :SEG|277->285|egeeeeqgg 301: . . . . + .: 360 :IDPVNGSSLGREPKPTQPLDSNKPNGESGAKTPAPEFTQNRKTSLTSRDLRSLRAQLWEC:Sequence : :Sec Str 361: . . . * . .: 420 :AAALAEHHGLGEAVIQLKDQGLGLLLVEVPPQELIDTLDPDMLGLVSALWWQLAASAELT:Sequence : :Sec Str 421: . . + . . .: 480 :VAPIDIVLHYLNKSSALHEALASHDAGLLFSSVWTPDPGHMSSLLWQQLNPPDWQVLLRM:Sequence : :Sec Str 481: . * . . . .: 540 :METYRAIKRLAYDTGIELWVPIAGGGNVIQ :Sequence : :Sec Str