[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA57191.1"

            "transposase, IS4 family"
            ""

OrgPattern -------------------------------------------------------------------- 1---------------------------------------------------------------------------------------------1-----------------------------------7---------------91--111--------------------------------------------------------------------------------------------------------B7---------N1------------------------------------------------------1------------------------------5----A1---1---------------------C-21---1--3------------------------------2---3----------6-------------5-------------------------------------------------------------1--------1--------6------5---5-----------------------1-----1----------1-----------2-------------------------2------1----------------------------1-------------------------------------------------------------------------------------------------------------2----------------------------------------------------------------------1G3I4***------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKPQTPPDLPTDDLFRHRLENLIDTRHELAKLAALIDWEFFDAQWGEAFCENGRPAIATR:Sequence : XXXXXXXXXX :SEG|5->14|tppdlptddl : ==============================================:BL:SWS|15->188|YNF8_RHIME|3e-54|54.6|174/207 : $$$$$$$$:RP:PFM|53->121|PF05598|6e-05|36.4|66/76|DUF772 61: . . . * . .: 120 :LIAGLHYLKHTYGLSDEQVVQRWAENPYWQYFCGERYFQHELPLNPSSLTRWRQRLGDEG:Sequence :============================================================:BL:SWS|15->188|YNF8_RHIME|3e-54|54.6|174/207 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|53->121|PF05598|6e-05|36.4|66/76|DUF772 : $$$$$$$$$$$$$$$$$:RP:PFM|104->165|PF06021|4e-05|36.1|61/199|Gly_acyl_tr_N 121: . . + . . .: 180 :MESLLSATIDAAIASKAVKARDLKCVTVDTTVQEKAIAFPTDSKLYNRARERLVRLAKAH:Sequence :============================================================:BL:SWS|15->188|YNF8_RHIME|3e-54|54.6|174/207 :$ :RP:PFM|53->121|PF05598|6e-05|36.4|66/76|DUF772 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|104->165|PF06021|4e-05|36.1|61/199|Gly_acyl_tr_N 181: . * . . . .: 240 :GVPLRQSYVRVGPRLLFKNNRYGYARQTRRMRRTAAKLKTVLGRVVRDIERKLPKQSASV:Sequence : XXXXXXXXXXXXXXXX :SEG|201->216|rygyarqtrrmrrtaa :======== :BL:SWS|15->188|YNF8_RHIME|3e-54|54.6|174/207 241: + . . . . *: 300 :QAAFAESMALTKRLLDQQRHDKNKLYALHAPEVECIAKGTAHKRYEFGVKVSIATTNRSN:Sequence : ===================:RP:SCP|282->421|2ebfX3|1e-07|6.8|132/192|d.3.1.17 : =====================================:BL:SWS|264->370|Y4RI_RHISN|3e-04|30.4|102/100 : $$$$$$$$$$$$$:RP:PFM|288->376|PF01609|8e-06|32.9|82/192|Transposase_11 301: . . . . + .: 360 :LVVGAQSLPGSPYDGHTLKKALHQVERLTGQRPERCYVDLGYRGHDVDDVDVFKARQKRG:Sequence :============================================================:RP:SCP|282->421|2ebfX3|1e-07|6.8|132/192|d.3.1.17 :============================================================:BL:SWS|264->370|Y4RI_RHISN|3e-04|30.4|102/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|288->376|PF01609|8e-06|32.9|82/192|Transposase_11 361: . . . * . .: 420 :VTRTIRRELKRRNAIEPIIGHMKNDGLLHRNYLKGVEGDAINAILCGAGQNLRLILRYLR:Sequence :============================================================:RP:SCP|282->421|2ebfX3|1e-07|6.8|132/192|d.3.1.17 :========== :BL:SWS|264->370|Y4RI_RHISN|3e-04|30.4|102/100 :$$$$$$$$$$$$$$$$ :RP:PFM|288->376|PF01609|8e-06|32.9|82/192|Transposase_11 421: . . + . . .: 480 :IFWLKIQPAFIQYLLLAPPRAA :Sequence := :RP:SCP|282->421|2ebfX3|1e-07|6.8|132/192|d.3.1.17