[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA57445.1"

            "ABC transporter, inner membrane subunit"
            ""

OrgPattern 33413-32333343-4351221113336435212---1-----113-42-C95-54432131214-1- -113C343444-3112222-2211292222224333145613-44A9423336A632411442395667A42222422322-411111--------2--------11--122222222222222211111111121465852216A3321333221111-111322142221-1-11-11-1194433881423666664564546445976663655314B521222222E6144434444444444333122222332-12111--33111112234333333311112211111112222222222222221111211111C26244434541422222111153143B-11198631-282-3462164311----1121132GGO115854919AAA9AA8AAJ-44B4393CPM1-hQQVJJCVTMMOK3-114CC96AA6CD1111111122222219-------------------------------11--BFBCC66777644555559955552566E5387113342353353B5BQ241142242-------111221346132352233331111111211----1211-11--------222222122-3-12114321211111411111-111111-111111--13321------76IC2987777777777-77777777777776767759A9B93355555555555555555876666674-555555545555--1111111111111747444-12322124122222221212333332335572644429A91----1---245565555556588----------------12111111222122126-111-11-1122111222122122---338449E988212 -----------------------------------------------------------------------------------------------------------------1--------------------------------------------2----2---------1-----------1--1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLAYIVRRILYAIPILVGVNILTFALFFGINSPDDMARMHLGTKRVTQEAIDAWKRERGY:Sequence : :Sec Str :============================================================:BL:SWS|1->323|Y209_BRUME|1e-31|32.2|301/315 61: . . . * . .: 120 :DKPLFWNSDAKGEDKFTETIFFTKSISLFLFQFGHADDGRDIGHDLRTRMWPSLAIAAPI:Sequence : :Sec Str : ============================:RP:SCP|93->323|2r6gG1|5e-09|9.6|219/284|f.58.1.1 :============================================================:BL:SWS|1->323|Y209_BRUME|1e-31|32.2|301/315 121: . . + . . .: 180 :FIGGLLVNTTFALLMVFFRGTYLDLGGVVLCVALMSISTLFYVIMGQYLVGKLMHLVPVS:Sequence : :Sec Str :============================================================:RP:SCP|93->323|2r6gG1|5e-09|9.6|219/284|f.58.1.1 :============================================================:BL:SWS|1->323|Y209_BRUME|1e-31|32.2|301/315 181: . * . . . .: 240 :GYVGGLDAFKFIILPIIIGIISGIGAGARWYRTLFLEEVGKDYVRTARAKGLSEFKVLFK:Sequence : HccTTTTTHHHHHTccTHHHHHH:Sec Str : XXXXXXXXXXXXXXXX :SEG|192->207|iilpiiigiisgigag :============================================================:RP:SCP|93->323|2r6gG1|5e-09|9.6|219/284|f.58.1.1 :============================================================:BL:SWS|1->323|Y209_BRUME|1e-31|32.2|301/315 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|209->323|PF00528|2e-04|36.9|111/195|BPD_transp_1 241: + . . . . *: 300 :HILKNALIPILTGAVVILPTLFLGSLILESFFGIPGLGSYTIDAIQAQDFAIVRAMVFLG:Sequence :TTHHHHHHHHHHHHHH :Sec Str :============================================================:RP:SCP|93->323|2r6gG1|5e-09|9.6|219/284|f.58.1.1 :============================================================:BL:SWS|1->323|Y209_BRUME|1e-31|32.2|301/315 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|209->323|PF00528|2e-04|36.9|111/195|BPD_transp_1 301: . . . . + .: 360 :SVLYILGLILTDISYTLVDPRVRLN :Sequence : :Sec Str :======================= :RP:SCP|93->323|2r6gG1|5e-09|9.6|219/284|f.58.1.1 :======================= :BL:SWS|1->323|Y209_BRUME|1e-31|32.2|301/315 :$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|209->323|PF00528|2e-04|36.9|111/195|BPD_transp_1