[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABA57445.1 noce0 ABA57445.1 "ABC transporter, inner membrane subunit"
MLAYIVRRILYAIPILVGVNILTFALFFGINSPDDMARMHLGTKRVTQEAIDAWKRERGY
DKPLFWNSDAKGEDKFTETIFFTKSISLFLFQFGHADDGRDIGHDLRTRMWPSLAIAAPI
FIGGLLVNTTFALLMVFFRGTYLDLGGVVLCVALMSISTLFYVIMGQYLVGKLMHLVPVS
GYVGGLDAFKFIILPIIIGIISGIGAGARWYRTLFLEEVGKDYVRTARAKGLSEFKVLFK
HILKNALIPILTGAVVILPTLFLGSLILESFFGIPGLGSYTIDAIQAQDFAIVRAMVFLG
SVLYILGLILTDISYTLVDPRVRLN
//