[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABA57485.1 noce0 ABA57485.1 "hypothetical protein"
METGEMILVGTIAFIAIVSVALIYAWFSLNGLIKAAIERYGTQITQTRVQISTVKIAPTA
GGGTISRLTISNPPGFSSSSLIALDTISIKIDASTLRQNPIIIKEIIFHSPQVFFEISLS
GKSNIGVLRKNIVTAGEFIPLRLKQTGKKEIKLVIQRLTIEEGQIHAAISGLEGRQLTGK
LPRLELTDIGNEKGGFSPKEMAEEIIAALINPVDSAASKLRAKTEEYLRHAL
//