[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA57493.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-------------11111111111---------11--111111111111--1--1111111111---------------------------------------------1------1111---------------------------------------------------------------------1-------------------------------------------------------111111111111111111111111111111--1111---------------------------------------------------------------------------------------------111111111111-----------------------------11-111-11---------22222222211111-----11111--------------111-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEYETSRRIFYPPIKYCFIILFLLSLLTGCASTPPASTANLCVIFEKQPEWYDYAKESEK:Sequence : cccHHHHHHHHHTTcTT:Sec Str : ==========:RP:SCP|51->180|1qsaA2|5e-09|15.4|117/168|d.2.1.6 61: . . . * . .: 120 :KWGTPTPILMAFIHRESSFRGDARPPRRWFLGFIPLPRSSSAYGYGQIQDPAWEDYLGAN:Sequence :cTTccHHHHHHHHHHHHTTcTTcEEEcTTcEEEEEcTTccEEETTTTEETTTTccccccc:Sec Str :============================================================:RP:SCP|51->180|1qsaA2|5e-09|15.4|117/168|d.2.1.6 121: . . + . . .: 180 :GGWFKSRADMEDVLDFIGWYNHISARRLGISKRNPEHLYLAYHEGHRGYQRGAWRRKPHL:Sequence :TTcccTTcccGGGGGccccHHHHHHHHHHHTcccGGGGcHHHHHHTTTccGGGGGTGccc:Sec Str :============================================================:RP:SCP|51->180|1qsaA2|5e-09|15.4|117/168|d.2.1.6 181: . * . . . .: 240 :RRVAKRVARQARMYGSQLKSCEDRFKCRKFYQFWPFCR :Sequence : :Sec Str :XXXXXXXXXXXX :SEG|181->192|rrvakrvarqar