[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA57498.1"

            "conserved hypothetical protein"
            ""

OrgPattern ------------------------11111111----------------------------------11 --1--------------11-1-111-111111--------------------------------------------------1---11-----------1-2-121222---------------1---------3----11-----1111111111111111111112221111111111111---11----1-------------------------111----------1-------------------------------------------------------------------------------------------------------------------------------1---------------3---------------1----------------------------------------12-------1-----1--------------12-1111111111---------------11111-1----------------------1-------------------1-------1---21111---------1111-11---------------------1-----12-1-------------------------11-----2-----------1---------------1111---------------------------------------------------------------------------------------------1111111111-11---------------------------1--------------------------1----------------------------1-1---1111----------------------------------------------12- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----112111-33------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MARTESMMLDLGTQAPDFQLLEPATGRTVSLADFKGAGGLLVIFMCNHCPYVKHISSALS:Sequence :EEcHccccccTTccccccEEEEcTTccEEEGGGcccccEEEEEEEccccHHHHTTHHHHH:Sec Str : ========================================================:RP:SCP|5->190|2cvbA1|6e-40|44.5|182/187|c.47.1.10 : =========================================================:BL:SWS|4->134|RESA_GEOTN|7e-10|32.0|122/174 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|11->137|PF08534|3e-15|37.3|118/132|Redoxin 61: . . . * . .: 120 :QFAREYQPKGLAIVGISVNDVENYPDDSPEKMAEEVEAQGYIFPYLYDETQEIAKAYKAA:Sequence :HHHHHTTTTEEEEEEEEcccTTTcGGGccHHHHHHHHHHTccccEEEccccHHHHHTTcc:Sec Str :============================================================:RP:SCP|5->190|2cvbA1|6e-40|44.5|182/187|c.47.1.10 :============================================================:BL:SWS|4->134|RESA_GEOTN|7e-10|32.0|122/174 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|11->137|PF08534|3e-15|37.3|118/132|Redoxin 121: . . + . . .: 180 :CTPDFFLFDKNHKLVYRGQFDDSRPGNDLPVTGEDLQTAVKAVLSGQPIPNEQRPSMGCN:Sequence :EEcEEEEEcTTccEEEEEccccccTTcGGGccccHHHHHHHHHHTTccccccccccccEE:Sec Str :============================================================:RP:SCP|5->190|2cvbA1|6e-40|44.5|182/187|c.47.1.10 :============== :BL:SWS|4->134|RESA_GEOTN|7e-10|32.0|122/174 :$$$$$$$$$$$$$$$$$ :RP:PFM|11->137|PF08534|3e-15|37.3|118/132|Redoxin 181: . * . . . .: 240 :IKWKPGNEPDYFG :Sequence :ccccTTccccT :Sec Str :========== :RP:SCP|5->190|2cvbA1|6e-40|44.5|182/187|c.47.1.10