[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA57708.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------1-------------------------1-1---------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------1----------------------------------------------------------------------1----------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNTIATPMQYLDKAMNQLHDLGLLSEGERQEAPIIALLNQISDLDQARVTAIARTLNQAS:Sequence : TTcGGGHHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str : ==================================:BL:SWS|27->392|ODFP2_RAT|4e-08|22.6|349/825 61: . . . * . .: 120 :LFNEVVREQVQAMEIGERYEEITHAFNSIRDDAKSMVEQAEDGKIDTFERLGNIWMKVSR:Sequence :HHHHHHHHHHHHTTTTccTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccc :Sec Str :============================================================:BL:SWS|27->392|ODFP2_RAT|4e-08|22.6|349/825 121: . . + . . .: 180 :GDIATRFDKIKETYLEVTASTHDQIQREQKILQAYQDFRGALKQSEVLALEVLKTAEGKL:Sequence : :Sec Str :============================================================:BL:SWS|27->392|ODFP2_RAT|4e-08|22.6|349/825 181: . * . . . .: 240 :DAAKADVKGAMKMIETYQGEEVAERAKLELARDEKVRLLQNEEKRYQIAKDLSDNLTISY:Sequence : HHTccccGGGHHHHHH:Sec Str :============================================================:BL:SWS|27->392|ODFP2_RAT|4e-08|22.6|349/825 241: + . . . . *: 300 :NTSEVVMARLIQTTNAKERVYAQAVSFFSTNEVVLTALTASFTGMFGLHESTRTVEAMKE:Sequence :HHHHHHHHHHHTcccccccccccEEEEEcc cccccccHHHHHHHHTcHHHHH HHHHT:Sec Str :============================================================:BL:SWS|27->392|ODFP2_RAT|4e-08|22.6|349/825 301: . . . . + .: 360 :GVSQSLEVLADIGGKVQEAAVKAGYGPTVRADAVKKLVDSVVNWQSRSHEIIEEMRRQST:Sequence :T cccHHHHHT :Sec Str :============================================================:BL:SWS|27->392|ODFP2_RAT|4e-08|22.6|349/825 361: . . . * . .: 420 :ANAREIRNAVEESKRKLARLAEAGKGVAVAAQ :Sequence : :Sec Str :================================ :BL:SWS|27->392|ODFP2_RAT|4e-08|22.6|349/825