[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA57747.1"

            "cytochrome/quinol oxidase subunit 3"
            ""

OrgPattern 11----------------------1----1-------------------------------------- -12----11111--11111-1-1111111111111111-----1---1------------------------------------------------------------11--------------1-----------111-------------1--------------------------------------2-1---------------111111----1-1---111111-1---------------1------------------------------------------------------------------------------------------------------1-----------------------1-------------11----11-1111111111--11211112-1--11111-1-1-111-----------------------11--------------------------------------1-----1--------------2---------13------1---22---11-1---11-1-----------1-11-----11---111-1---111--221222------------------------------1-1--2------111-1-11111--11-1---1---------1--1-11---------------------------------------1-------------------------11111111111----11111------------------------------------111111---1111-111-------------1----------1-----------------111111-----------------------------------------------2- ----------------------------------------------------------------------------------------------------------------1-1-1-----1--------------------11------------------------------------------------------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSDKHTAVAEQFDDPEQEYHAATLGMWVFLATEVLFFGVLFASYAVSRFNYPEAFAEASR:Sequence : HHHHHHHHHHHHHHHHHHHHHHHHcccGGccccTTc:Sec Str : =====================================:RP:SCP|24->210|1fftC|3e-24|23.6|174/185|f.25.1.1 : ===========================================:BL:SWS|18->211|QOX3_BACSU|3e-15|28.7|181/204 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|25->209|PF00510|2e-06|28.0|168/212|COX3 61: . . . * . .: 120 :HTDIVLGTISTGVLLTSGFTMALAVRSAKLGRDKAIIGFLVLTILLAIAFLFIEGTEYYQ:Sequence :ccTTcHHHHHHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXXXX :SEG|99->113|flvltillaiaflfi :============================================================:RP:SCP|24->210|1fftC|3e-24|23.6|174/185|f.25.1.1 :============================================================:BL:SWS|18->211|QOX3_BACSU|3e-15|28.7|181/204 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|25->209|PF00510|2e-06|28.0|168/212|COX3 121: . . + . . .: 180 :AYGEQLIPAFNFMYEGAHEKPVELFFFLYFLMTGMHAVHVTIGILIMAAIAIMAGRRRFT:Sequence :c cccTTHcHHHHHHcccTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccc:Sec Str : XXXXXXXXXXXXXX :SEG|162->175|igilimaaiaimag :============================================================:RP:SCP|24->210|1fftC|3e-24|23.6|174/185|f.25.1.1 :============================================================:BL:SWS|18->211|QOX3_BACSU|3e-15|28.7|181/204 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|25->209|PF00510|2e-06|28.0|168/212|COX3 181: . * . . . .: 240 :SYYYTPVELTGLYWAFVDIVWIFLYPLFYLVART :Sequence :ccccHHHHHHHHHHHHHHHHHHHHHHHTTcc :Sec Str :============================== :RP:SCP|24->210|1fftC|3e-24|23.6|174/185|f.25.1.1 :=============================== :BL:SWS|18->211|QOX3_BACSU|3e-15|28.7|181/204 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|25->209|PF00510|2e-06|28.0|168/212|COX3