[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABA57747.1 noce0 ABA57747.1 "cytochrome/quinol oxidase subunit 3"
MSDKHTAVAEQFDDPEQEYHAATLGMWVFLATEVLFFGVLFASYAVSRFNYPEAFAEASR
HTDIVLGTISTGVLLTSGFTMALAVRSAKLGRDKAIIGFLVLTILLAIAFLFIEGTEYYQ
AYGEQLIPAFNFMYEGAHEKPVELFFFLYFLMTGMHAVHVTIGILIMAAIAIMAGRRRFT
SYYYTPVELTGLYWAFVDIVWIFLYPLFYLVART
//