[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA57806.1"

            "1-Cys peroxiredoxin"
            ""

OrgPattern 111111422222222311212221-----1----111111211-1-1211112-121112244311-1 2232-11----11111111-1-11211111121---1121-2-3---1---------------1-1-111--1111111-12-211112211-2111--112222232-211111111111111122232122232-----1111-6465443545511221233554445211112211112-1-1122-3111111121111112211122121122121-1111111132-111111111111111--1-1-1-11-1-----1111---11-1111111111--------------1111111111111---------1121-1-----------111-11-2111111---112---11--112-1111112112-----232222211112211111111111-111112--121-211-1111111122-12111----111222222221552311211111111111111111111111111111-214112333555555423333555544443464632341133112111113112221-31411-------112122213--111122111-2232222-1222212--2211121221121222222211122112223422222-22222232222221222221-121--11111121221211111111111-11211111111111111112222211222222222222222221111111111111111111111111322222222213122---1-1-1--1-111222221422223444433332333322222-1111-1-111121111122222111111111111111111332222--------11--------------------------11111111111-1 3311325-A8333333243233222221111111111111111111221123231111111133333323333332322334232211-34122322222211445132296C66584143353C7372FR8176C3333935753454363254555655434444A5573444133183223443744342195B63 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MALHIGDVAPDFTQESTIGPLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFK:Sequence :cEccTTcccccEEEETTEEEETHHHHTTTcEEEEEEccccccHHHHHHHHHHHHTHHHHH:Sec Str : ==========================================================:RP:SCP|3->210|1prxA|3e-38|51.2|207/220|c.47.1.10 : ==========================================================:BL:SWS|3->212|PRDXL_DICDI|2e-75|59.8|209/241 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->134|PF00578|4e-19|44.2|120/122|AhpC-TSA 61: . . . * . .: 120 :KRDVKVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVT:Sequence :HTTEEEEEEEcccHHHHHHHHHHHHHHTcccccccEEEcTTcHHHHHTTcccTcTccccc:Sec Str :============================================================:RP:SCP|3->210|1prxA|3e-38|51.2|207/220|c.47.1.10 :============================================================:BL:SWS|3->212|PRDXL_DICDI|2e-75|59.8|209/241 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->134|PF00578|4e-19|44.2|120/122|AhpC-TSA 121: . . + . . .: 180 :VRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGDDCVIV:Sequence :cEEEEEEcTTccEEEEEEEEcTccccHHHHHHHHHHHHHHHHTTccccTTTTccTTcEEc:Sec Str :============================================================:RP:SCP|3->210|1prxA|3e-38|51.2|207/220|c.47.1.10 :============================================================:BL:SWS|3->212|PRDXL_DICDI|2e-75|59.8|209/241 :$$$$$$$$$$$$$$ :RP:PFM|5->134|PF00578|4e-19|44.2|120/122|AhpC-TSA : $$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|156->194|PF10417|2e-04|54.3|35/37|1-cysPrx_C 181: . * . . . .: 240 :PSLTDPEVLKEKFPKGYEEIKPYLRMTPQPNK :Sequence :cccccHHHHHHccccccEEEETTEEEEccccH :Sec Str :============================== :RP:SCP|3->210|1prxA|3e-38|51.2|207/220|c.47.1.10 :================================ :BL:SWS|3->212|PRDXL_DICDI|2e-75|59.8|209/241 :$$$$$$$$$$$$$$ :RP:PFM|156->194|PF10417|2e-04|54.3|35/37|1-cysPrx_C