[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA57898.1"

            "Universal stress protein UspA and related nucleotide-binding proteins"
            ""

OrgPattern -------11--11-1----1----------------1-------1-----4-2--------------- --------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------1------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNAQFNDIIEDIIVTVDGSENAKRAARFAARLAKTTKNKMTLLYVFPTRATSDFDFLSIT:Sequence : cccEEEEEccccHHHHHHHHHHHHHccccccEEEEEEEEEGGGTTccccccHH:Sec Str : XXXXXXXXXXXXXXXX :SEG|22->37|akraarfaarlakttk : =================================================:RP:SCP|12->151|1mjhA|4e-20|24.8|133/143|c.26.2.4 : ===================:BL:SWS|42->92|SP5G_STACT|3e-04|31.4|51/107 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->151|PF00582|3e-09|29.6|135/139|Usp 61: . . . * . .: 120 :HPEEEDNEQLKKETARKVFDEARRIIGDQDQEIKEEILTGDPATEIIHYLEKRPNTITVI:Sequence :HHHcGGGGGGTHHHHHHHHHHHHHHHHHTTcEEEEEEEEEcHHHHHHHHHHHHTccEEEE:Sec Str :============================================================:RP:SCP|12->151|1mjhA|4e-20|24.8|133/143|c.26.2.4 :================================ :BL:SWS|42->92|SP5G_STACT|3e-04|31.4|51/107 : ====================================================:BL:SWS|69->151|Y531_METJA|8e-11|32.5|83/170 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|12->151|PF00582|3e-09|29.6|135/139|Usp 121: . . + . . .: 180 :GRRGLSRFEALLLGSVSEKVVRHASGPVTIIH :Sequence :EccccccccTTcccHHHHHHHHHccccEEEEc :Sec Str :=============================== :RP:SCP|12->151|1mjhA|4e-20|24.8|133/143|c.26.2.4 :=============================== :BL:SWS|69->151|Y531_METJA|8e-11|32.5|83/170 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|12->151|PF00582|3e-09|29.6|135/139|Usp