[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABA57898.1 noce0 ABA57898.1 "Universal stress protein UspA and related nucleotide-binding proteins"
MNAQFNDIIEDIIVTVDGSENAKRAARFAARLAKTTKNKMTLLYVFPTRATSDFDFLSIT
HPEEEDNEQLKKETARKVFDEARRIIGDQDQEIKEEILTGDPATEIIHYLEKRPNTITVI
GRRGLSRFEALLLGSVSEKVVRHASGPVTIIH
//