[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA57974.1"

            "Roadblock/LC7"
            ""

OrgPattern ----------------------------------313111111----------1-------------- ----------------------------------------1------------------------------------------1-112----------------------------------------------2-11122---3----2---11----------1-------------------2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------2-----2-------------1111111-------1-------------------------------------------------------22---------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRADMLTAVLNDLNSTSADIEASGVISTDGLMIAAVLPTTLDEDRVGAMSAAMLSLGDRS:Sequence : TTGGGTcccEEEE EETTccEEEEcTTccccHHHHHHHHHHHHccHHHH:Sec Str : ===========================================:RP:SCP|18->117|1j3wA|9e-15|23.0|100/134|d.110.7.1 :============================================================:BL:SWS|1->119|Y714_METJA|1e-16|38.5|117/118 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|25->95|PF03259|2e-06|39.4|71/90|Robl_LC7 61: . . . * . .: 120 :AKELERGALEQVLIKGDHGYVLMTYAGDEAVLTVMAKPRAKLGLIFLDVKRAAESIASMI:Sequence :HHcEEETTEEEEEEEEcccEEEEEEEcccEEEEEEEcTTccHHHHHHHHHHHHHHHHTT :Sec Str :========================================================= :RP:SCP|18->117|1j3wA|9e-15|23.0|100/134|d.110.7.1 :=========================================================== :BL:SWS|1->119|Y714_METJA|1e-16|38.5|117/118 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|25->95|PF03259|2e-06|39.4|71/90|Robl_LC7