[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA57977.1"

            "3-deoxy-D-arabinoheptulosonate-7-phosphate synthase"
            ""

OrgPattern -------------------------------------------------------------------- 11--1--1111-1--1-----1---1------11111111-----11-1---111-----11--111---12222222----1-----------------------------------------11111111111111111-----1-11---1111111111--11111-111111111111111------------------------------------------------------------------------------------------212111----12222222222222-------------222122222-----2------------11----1-----11--11---------------1-1111--------111---1-1-----------------------1--1---11-111---------1-----1----------------------------------------------------2221222222222222222222221222212221122221222232221112111121111111111-222--1------------1111111122222-11----------------------------4421213-1-23333333333333333333111111111111133333333334334433-333333333334333333333333333333333333323333333333333313233333323331111111111111122212222-2211112112222222211121222222222222222221111111111333423333333441111111111111111--11------------1-------------------------------------131 ------------1122222233422232222222223222322222222222221222222222322222223332223221222222-23222222222262436-2--------------------------------------------------------------2------------------3----4233- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSFPTEDLRIKNIQEVIPPAQLHEGLPITSEASKTVYRTRQAIQEVLGGKDDRLLVVAGP:Sequence : ccTTcccccccccccccHHHHHHHccccHHHccccccccEEETTEEEcTTcccEEEEEE:Sec Str : ======================================================:RP:SCP|7->349|1gg1A|e-149|58.4|339/339|c.1.10.4 :============================================================:BL:SWS|1->349|AROG_ECOLI|e-115|57.0|349/350 : $$$$$$$$$$$$$$$$$$:RP:PFM|43->338|PF00793|2e-62|53.6|263/278|DAHP_synth_1 61: . . . * . .: 120 :CSIHDPQAARDYGKRLKLLIDELADELLIVMRVYFEKPRSTVGWKGLINDPHLDGSFQIN:Sequence :EEcccHHHHHHHHHHHHHHHHHHHHTccEEEEEEcccTTcccccccccHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXXX :SEG|76->89|lkllideladelli :============================================================:RP:SCP|7->349|1gg1A|e-149|58.4|339/339|c.1.10.4 :============================================================:BL:SWS|1->349|AROG_ECOLI|e-115|57.0|349/350 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|43->338|PF00793|2e-62|53.6|263/278|DAHP_synth_1 121: . . + . . .: 180 :EGLRLARRLLLDLAETGVPAGTEYLDLVSPQYIADLIAWGAIGARTTESQVHRELASGLS:Sequence :HHHHHHHHHHHHHHHHccEEEEEcccGGGHHHHHTTccEEEEcGGGTTcHHHHHHHHHTT:Sec Str : XXXXXXXXXXXX :SEG|123->134|lrlarrllldla :============================================================:RP:SCP|7->349|1gg1A|e-149|58.4|339/339|c.1.10.4 :============================================================:BL:SWS|1->349|AROG_ECOLI|e-115|57.0|349/350 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|43->338|PF00793|2e-62|53.6|263/278|DAHP_synth_1 181: . * . . . .: 240 :CPVGFKNATNGSLGAAMSAIVSASKPHHFLSLTLAGRSAIFSTAGNPDCHLILRGGQKPN:Sequence :cEEEEEccTTccGGGGHHHHHTTcccTTccGGGHHHHHHHHHHTTcccEEEEEccEEccc:Sec Str :============================================================:RP:SCP|7->349|1gg1A|e-149|58.4|339/339|c.1.10.4 :============================================================:BL:SWS|1->349|AROG_ECOLI|e-115|57.0|349/350 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|43->338|PF00793|2e-62|53.6|263/278|DAHP_synth_1 241: + . . . . *: 300 :YDAASVNETAHNLIQTGLRPQVMIDCSHGNSSKNPKKQVLVARDIAGQIAAGDRRIMGVM:Sequence :ccEEccTHHHHHHHHHTTcccEEEEHHHHTccGGGHHHHHHHHHHTcHHHHcHHcccEEE:Sec Str :============================================================:RP:SCP|7->349|1gg1A|e-149|58.4|339/339|c.1.10.4 :============================================================:BL:SWS|1->349|AROG_ECOLI|e-115|57.0|349/350 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|43->338|PF00793|2e-62|53.6|263/278|DAHP_synth_1 301: . . . . + .: 360 :LESHLVAGRQDVIPNTPLTYGQSITDACIGWEESEQLLREFARAIQKRRQMPEKHIEAKH:Sequence :EEEEccGGGccTTTcEcccGGGcEEGGGHHHHHHHHHHHHHHHHHHHccccccc :Sec Str :================================================= :RP:SCP|7->349|1gg1A|e-149|58.4|339/339|c.1.10.4 :================================================= :BL:SWS|1->349|AROG_ECOLI|e-115|57.0|349/350 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|43->338|PF00793|2e-62|53.6|263/278|DAHP_synth_1 361: . . . * . .: 420 :GCSATP :Sequence : :Sec Str