[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA57987.1"

            "Transposase"
            ""

OrgPattern ------1-7114--9--1------2--1323B-1---2----------215F3-----1---11---- ----1------------22-22----22222-1---2-76-18K------------------1---B3113----41----------1--------------------2---------------------------C-12----4-23Z4ID*CB11------21X39M25-------------28-----1A-33333-5C35331351-----2345111-D3------4----------------1----11-----9-H1--55---2---------------------------------------------------33---------2-4--922-53M35--4--11211A----2---1-1--7-----------------------------------------1-1--------------------------------111111111-----------------------------------------------B77-3B-------1-------1----1------------A1----------------------2----1--------------------------------------3-2-51----------2-----2----31--------4------------2H-------------3--12221-1-32-22132113132-3111111-------D---1---1--11211221111233------------------------------1-------------74---------1J5----------------------------------------------------1-32----------1115--1-------------------------------54-211-1D-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLKATKIRLYPTREQAEFLNRQFGSVRFCYNTGLRIMSHRYKRHGQSLSAKYDIKKLLPV:Sequence : :Sec Str : ==========================================================:BL:SWS|3->352|YSNA_STRPR|2e-39|36.0|342/402 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|1->46|PF12323|9e-09|52.2|46/46|HTH_14 61: . . . * . .: 120 :AKKSRKYGWLKEADSVALAQACINLDKAFQRFFKEKKGYPRFKRKRGKQSSYHCMSVSCG:Sequence : cEEEEEEEEccTcEEEEEEEEcccc:Sec Str :============================================================:BL:SWS|3->352|YSNA_STRPR|2e-39|36.0|342/402 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|72->279|PF01385|1e-35|40.4|203/207|Transposase_2 121: . . + . . .: 180 :ESWVKVPKLGPIKARVHRSVEGKLKSITLSRTVTGKHYASLLYETEQPVPEPMTAIDATK:Sequence :cc EEEEEEEcccccEEEEcTTcccEEEEEccccEEEEEccTTccEEEEEEE cTT:Sec Str :============================================================:BL:SWS|3->352|YSNA_STRPR|2e-39|36.0|342/402 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|72->279|PF01385|1e-35|40.4|203/207|Transposase_2 181: . * . . . .: 240 :VLGLDMGLSHLAIDSTGRKVANPRFIKQVQKNLKRKQQSLSRKQKGSSKRAKARLLVAKA:Sequence :ccHHHHHHHHHHHHccc ccccccc :Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXXXXX:SEG|213->240|lkrkqqslsrkqkgsskrakarllvaka :============================================================:BL:SWS|3->352|YSNA_STRPR|2e-39|36.0|342/402 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|72->279|PF01385|1e-35|40.4|203/207|Transposase_2 241: + . . . . *: 300 :HERVADARSDFQHKLSRQIVDDNQAVIVETLKVNNMMKNAKLAKHIGDASWHALIAKLAY:Sequence : HHHHHHHHHTTccEEEEEEEEEETTccccHHHHHHH:Sec Str : ==:RP:SCP|299->351|1wj0A|4e-15|18.9|53/58|g.72.1.1 :============================================================:BL:SWS|3->352|YSNA_STRPR|2e-39|36.0|342/402 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|72->279|PF01385|1e-35|40.4|203/207|Transposase_2 : $$$:RP:PFM|298->358|PF07282|8e-11|46.7|60/70|Transposase_35 301: . . . . + .: 360 :KAKEQGKHLVKIDPWFASSKTCHVCQHKMDAMPLNIRSWACPTCHTRHDRDINAALNIQH:Sequence :HHHHTTcTTTTcEEEEEEEccETTTccEE ccccccccccccccccEE :Sec Str :=================================================== :RP:SCP|299->351|1wj0A|4e-15|18.9|53/58|g.72.1.1 :==================================================== :BL:SWS|3->352|YSNA_STRPR|2e-39|36.0|342/402 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|298->358|PF07282|8e-11|46.7|60/70|Transposase_35 361: . . . * . .: 420 :QGILKLKAEGLSVSAHRGLRKSGMPPVAAVEVGSSVR :Sequence : :Sec Str