[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABA58004.1 noce0 ABA58004.1 "hypothetical protein"
MGQIAIYLDDKTEQPLKSAAAAAKMPVSLWVAALVKDKTRTQWPDSVRELAGAWSDFPEA
ETLRRETTADVPREPL
//