[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA58119.1"

            "serine O-acetyltransferase"
            ""

OrgPattern ------------------------211111-111--------111-11-111---------------- 1111-111111111-1111-1-111-111111-----1---231-1111111111111----11--1------------111------1111-2-----212111122-2---------------11132111211222111111-2232223111211111111123232111111111111-1---111111111111111111111111111111111211111111111111111111111111111111--------1-11---1----2111111111111111111111111111111111111111112221111111121111111111111111111111-11111111111111111111-11-11111-----223451112321211111111111-22222322111-3111221232112211111323222211111111112211222-----------------------------111211111113233332333322223333124351111-1112121112322321311222121111111211132111-1111121111-112112111111123111111111111111111111111111221112111121111111111111111111221--11111--11122111212222222221-2222222222232222222111112112222222222222222222122221-1111111111111111---------31211111111111111111222221311133221122231434332331--------111211111111111--------------1111111111------------------------------------1111111111111 --------11--------------------------------------------------------------------------------------------------51------------------------------------------------------------3----2233R333224526-5313----6 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MFKRLQEEIKCVFERDPAARNAFEVITTYPGFHAIVWHRLSHRLWNLGAKWLARAISTLS:Sequence :cEEcccEccEEcccccTTccEEGGGTcccTTEEEccccEEccGGGcccGGGGEETccccc:Sec Str :============================================================:RP:SCP|1->168|1s80A|5e-42|37.5|168/241|b.81.1.6 : =======================================================:BL:SWS|6->220|NIFP_AZOCH|7e-53|52.0|202/269 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|8->35|PF06426|3e-05|53.6|28/105|SATase_N 61: . . . * . .: 120 :RWLTGIEIHPGAQIGQRFFIDHGMGVVIGETAEIGNDCTLYHGVTLGGTSWQKGKRHPTL:Sequence :cccccEEEccccEEcTTcEEEcTTTTccTTccccccGGGcccGGGTTccccccccccEEE:Sec Str : X:SEG|120->134|lgnnvvvgagakvlg :============================================================:RP:SCP|1->168|1s80A|5e-42|37.5|168/241|b.81.1.6 :============================================================:BL:SWS|6->220|NIFP_AZOCH|7e-53|52.0|202/269 121: . . + . . .: 180 :GNNVVVGAGAKVLGPIHIGSGVRIGSNSVVVKSVPANTTVIGVPGRMVQSKDQRREAKHQ:Sequence :ccccEEcTTcEEcTTcEEcTTcEEcTTcEEcccccTTEEEETTTTEEEEEcccHHHHHHH:Sec Str :XXXXXXXXXXXXXX :SEG|120->134|lgnnvvvgagakvlg : ############################# :PROS|126->154|PS00101|HEXAPEP_TRANSFERASES|PDOC00094| :================================================ :RP:SCP|1->168|1s80A|5e-42|37.5|168/241|b.81.1.6 :============================================================:BL:SWS|6->220|NIFP_AZOCH|7e-53|52.0|202/269 181: . * . . . .: 240 :AMAKRIGFDAYGTPQDTPDPIERAIHGLIEHIQRLDERIEQMTAEIKNLGGDLPGEHLPS:Sequence :HHHcGGGccHHHHHHTHHHHTcccHHHHHHHHHHHHGGGHHHHHHHHHEEEEE :Sec Str :======================================== :BL:SWS|6->220|NIFP_AZOCH|7e-53|52.0|202/269 241: + . . . . *: 300 :LDEEQARQVAEDKSAIAK :Sequence : :Sec Str