[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA58132.1"

            "thymidylate kinase"
            ""

OrgPattern --1---1-111111111111111111111111---11------1111111111-1111111--11--- 11111-----------------------------------111111111111111111111111---111111111111111111111--------------------1-1111111111111111111111111111111111111--1---11111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1----------1---1------111--11--1111111111111--111111111111111111111111111111111111-11112111111111111111111111111111111111111111111111111-11111111111111111113111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111121111111111111-11111111111111111111111111111111111111111111111-1111111-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111-1---------114D321-111111111111111111111-1111111111 --------------1----1-------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLEGIEGAGKSTQLKFIQQLLQSTEKNVIVTREPGGTFLGEQIRELLLSPRLEGMSADTE:Sequence :EEcccccccHHHHHHcccccEEEEcccHHHHHTTccccHHHHHHHHHHHHHTcccHHHHH:Sec Str : ===========================================================:RP:SCP|2->205|1e2dA|1e-45|21.1|194/209|c.37.1.1 : ===========================================================:BL:SWS|2->204|KTHY_PSE14|2e-56|56.4|202/210 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->190|PF02223|2e-43|47.3|186/188|Thymidylate_kin 61: . . . * . .: 120 :LLLMFAARVEHVQQVIFPALAAGKWVLCDRFTSASYAYQGGGRELPLSRIAKLESWALNC:Sequence :HHHHHHHHHHHHGGGEEEEEEccEEEEEEccTHHHHTHHHHTTcccHHHHHHHHHTcccc:Sec Str :============================================================:RP:SCP|2->205|1e2dA|1e-45|21.1|194/209|c.37.1.1 :============================================================:BL:SWS|2->204|KTHY_PSE14|2e-56|56.4|202/210 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->190|PF02223|2e-43|47.3|186/188|Thymidylate_kin 121: . . + . . .: 180 :LRPDLILLFDVPVRLGLQRATTRCQQLDRFEQEKIDFFDRARTIYLSLAKKYPDQYRLID:Sequence :cTTcEEEEEEccHHHHHHHHHTTccTHcTTccccHHHHHHHHHHHHHHHHHHHHTTcGGG:Sec Str :============================================================:RP:SCP|2->205|1e2dA|1e-45|21.1|194/209|c.37.1.1 :============================================================:BL:SWS|2->204|KTHY_PSE14|2e-56|56.4|202/210 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->190|PF02223|2e-43|47.3|186/188|Thymidylate_kin 181: . * . . . .: 240 :SSLPLTRVQEAIQKVIMAFLEENRDA :Sequence :GTcccccGGGcGGGGcGGGccTTcc :Sec Str :========================= :RP:SCP|2->205|1e2dA|1e-45|21.1|194/209|c.37.1.1 :======================== :BL:SWS|2->204|KTHY_PSE14|2e-56|56.4|202/210 :$$$$$$$$$$ :RP:PFM|3->190|PF02223|2e-43|47.3|186/188|Thymidylate_kin