[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABA58132.1 noce0 ABA58132.1 "thymidylate kinase"
MLEGIEGAGKSTQLKFIQQLLQSTEKNVIVTREPGGTFLGEQIRELLLSPRLEGMSADTE
LLLMFAARVEHVQQVIFPALAAGKWVLCDRFTSASYAYQGGGRELPLSRIAKLESWALNC
LRPDLILLFDVPVRLGLQRATTRCQQLDRFEQEKIDFFDRARTIYLSLAKKYPDQYRLID
SSLPLTRVQEAIQKVIMAFLEENRDA
//