[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA58185.1"

            "metallo-beta-lactamase family protein"
            ""

OrgPattern 11----1111111112--11112215311213------1-1--121212121111111111---1-11 2122231455532334444-4633454444447667348824313-23-11-322222--23324551345-------1113411111111111111--3-111232222--------------2111--11----111221112122-11111111------112-1121------------12222--1333222222231223222123322322242112211111121233212322222322122111----------------------111111111111111111111111111-11111111111111111111211111111111111122111111111121111111111111111111-212133311111-32224432123122222222221-231241423231122221122123333322-1----2111111111111111212------------------------------43412-11-12222222111122221111112222323-322131222313111223431111111111111123115221111222111112111121211115244111111111111-1111111111111111134112-1111111-11111111111211-122121--11111111111111111111-1111111111111111111222111111111111111111111111111111111111111111111-1-----11112222-111111111111111222222212141322312222111111111--------111111111122111--1-1-----1---1-3111------------1-2--------------------------1----1---251 -----12-1--2122----11111121------------------------1-111--1211---------------------------12-------------11--22323122--1--11111-1-151-111-1111-11111-1111--1--125721312-11321-1---13M1111241352811---1-1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKFEILPVTRFMQNCTLLGCEESGKAAVVDPGGDVEQILARAEAGCLKIEKILLTHGHID:Sequence :EEEEEEEcccccccEEEEEETccTEEEEEccccEEEEccHHHHHTGGGEEEEEcccccHH:Sec Str : =========================================================:RP:SCP|4->207|1qh3A|2e-31|19.8|182/260|d.157.1.2 :============================================================:BL:SWS|1->212|YCBL_ECOLI|6e-73|55.7|212/215 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->163|PF00753|7e-14|38.4|138/171|Lactamase_B 61: . . . * . .: 120 :HAGGAGELARRLEVPIEGPQIEDEFWIDSLPAQSEMFGFPPVRAFVPDRWLEQGDRVSFG:Sequence :HHTTHHHHHHHHccccccEEEEEHHHHHHHHHHHHHTTccTTcTTcEEEEEcTTcEEEET:Sec Str :============================================================:RP:SCP|4->207|1qh3A|2e-31|19.8|182/260|d.157.1.2 :============================================================:BL:SWS|1->212|YCBL_ECOLI|6e-73|55.7|212/215 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->163|PF00753|7e-14|38.4|138/171|Lactamase_B 121: . . + . . .: 180 :KVVLNVYHCPGHTPGHVIFFHPESHLALVGDVLFKGSIGRTDFPRGDYDALIHSIRKRLF:Sequence :TTEEEEEEEcccccccEEEEEEETTEEEEEccccccccccTTccccccHHHHHHHHHccc:Sec Str :============================================================:RP:SCP|4->207|1qh3A|2e-31|19.8|182/260|d.157.1.2 :============================================================:BL:SWS|1->212|YCBL_ECOLI|6e-73|55.7|212/215 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|21->163|PF00753|7e-14|38.4|138/171|Lactamase_B 181: . * . . . .: 240 :PLGDEVRFIPGHGPMSTFGEERQSNPFVGEKI :Sequence :EEEEEcTTTTcccccccHHHHHHHHHHHHHHH :Sec Str :=========================== :RP:SCP|4->207|1qh3A|2e-31|19.8|182/260|d.157.1.2 :================================ :BL:SWS|1->212|YCBL_ECOLI|6e-73|55.7|212/215