[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABA58185.1 noce0 ABA58185.1 "metallo-beta-lactamase family protein"
MKFEILPVTRFMQNCTLLGCEESGKAAVVDPGGDVEQILARAEAGCLKIEKILLTHGHID
HAGGAGELARRLEVPIEGPQIEDEFWIDSLPAQSEMFGFPPVRAFVPDRWLEQGDRVSFG
KVVLNVYHCPGHTPGHVIFFHPESHLALVGDVLFKGSIGRTDFPRGDYDALIHSIRKRLF
PLGDEVRFIPGHGPMSTFGEERQSNPFVGEKI
//