[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA58187.1"

            "Protein of unknown function DUF482"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----111111111111111111111111-11111111111-1111111111111111111111111111111111111111111------------------------------1111-111111111111111111111111111111111111111111111111111111111----------111------1---11-------------111121-1------------------------------1111111--111111-111111111-1---1--1------------1-------------------------------------------------------------------------------1---------11111----------------------1111111111111111111111---------1--------------11111111121111----111111------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----111112-111------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEFKVTESIETVASGQWNALEGTDNPFLRYEFLSALERYGCVGAHVGWLPRYLLAEDRPG:Sequence : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->375|PF04339|e-108|52.9|367/369|DUF482 61: . . . * . .: 120 :SLIGAVPLYLKYNSFGEFVFDWSWADAWEQAGQHYYPKLVVAVPFSPVTGPRLLLKPGAD:Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->375|PF04339|e-108|52.9|367/369|DUF482 121: . . + . . .: 180 :EAMVDELIQMTIRLAKKGGISSLHWLFPHQKDRKRLANCGFLLRQGYQFHWHNRGYRDFN:Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->375|PF04339|e-108|52.9|367/369|DUF482 181: . * . . . .: 240 :DFLETLTSKRRKEVRRERRQAQTRGTEIKVIHGSEVTDLEWRAMYRFYQATFHAKGNYPA:Sequence : XXXXXXXXXXX :SEG|189->199|krrkevrrerr : =================================:RP:SCP|208->316|1ne9A2|5e-07|13.2|106/171|d.108.1.4 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->375|PF04339|e-108|52.9|367/369|DUF482 241: + . . . . *: 300 :LTLPFFKSLGRTMGQAVVLALAVRTGIPIAGALYLRSRDTLYGRYWGDSEYLAGMHFELC:Sequence :============================================================:RP:SCP|208->316|1ne9A2|5e-07|13.2|106/171|d.108.1.4 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->375|PF04339|e-108|52.9|367/369|DUF482 301: . . . . + .: 360 :YYRGIEYCIEHHLQYFEPGAQGEHKINRGFLPVLTWSAHWLGDSGFYSAIADFLAQESRM:Sequence :================ :RP:SCP|208->316|1ne9A2|5e-07|13.2|106/171|d.108.1.4 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|8->375|PF04339|e-108|52.9|367/369|DUF482 361: . . . * . .: 420 :VRSAIMELEAGGPYKRP :Sequence :$$$$$$$$$$$$$$$ :RP:PFM|8->375|PF04339|e-108|52.9|367/369|DUF482