[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABA58187.1 noce0 ABA58187.1 "Protein of unknown function DUF482"
MEFKVTESIETVASGQWNALEGTDNPFLRYEFLSALERYGCVGAHVGWLPRYLLAEDRPG
SLIGAVPLYLKYNSFGEFVFDWSWADAWEQAGQHYYPKLVVAVPFSPVTGPRLLLKPGAD
EAMVDELIQMTIRLAKKGGISSLHWLFPHQKDRKRLANCGFLLRQGYQFHWHNRGYRDFN
DFLETLTSKRRKEVRRERRQAQTRGTEIKVIHGSEVTDLEWRAMYRFYQATFHAKGNYPA
LTLPFFKSLGRTMGQAVVLALAVRTGIPIAGALYLRSRDTLYGRYWGDSEYLAGMHFELC
YYRGIEYCIEHHLQYFEPGAQGEHKINRGFLPVLTWSAHWLGDSGFYSAIADFLAQESRM
VRSAIMELEAGGPYKRP
//