[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA58208.1"

            "conserved hypothetical protein"
            ""

OrgPattern ------------------------------------------------2------------------- --------------1------1---1------1--------------------------------------------------------------------------------------------11111111111--------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------1-------1-1-111------------1-11---4--------11------------------111---------------------------1-1--------------1--------------------------1--------------------------------------------------------------------------1------1----1-----------------1--231------------21----1-1111--4-------------------------------13-121--11--1111111111-111----1----------------------------------------------------------------------------------------------------------11-----------------------------1111111111111-111-------------1----------111111111-------1-----11------------------------------------------1------ -----------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVRNSNRPTYYADVESCVENILSKVGKNIVLGIPIGLGKPNQLVNEFFRRATKDPTLRLK:Sequence : :Sec Str 61: . . . * . .: 120 :IFTALTLTKPQWKNGLERRLVEPLSARIFGNYPELDYISALERSQLPPNIEVAEFYFQPG:Sequence : :Sec Str 121: . . + . . .: 180 :QLLHNSHAQQNYVSSNYTHVVRDSLDSDMNVFAQLISSAKQWENKTYYSLSCNADLTPDL:Sequence : cTTcccTTHHHHH:Sec Str 181: . * . . . .: 240 :IPKMRGLEKSGKKIAILGQINPELPFMYGDAQVPSENFDAIVDHPQYAFKLFGPPNMAIN:Sequence :HHHHTTHHHccEEEEEEEcccGTTcccEEccEEEGGGccEEEEcccccccccccccHHHH:Sec Str : ======:RP:SCP|235->336,440->611|2g39A2|5e-37|26.5|225/274|c.124.1.2 : =============================================:BL:SWS|196->338,440->609|CAT2_CLOK5|1e-11|31.4|263/429 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|204->280|PF04223|8e-04|35.1|77/463|CitF 241: + . . . . *: 300 :PSDYMIGLHASALIKDGGTIQLGIGSLSDAVTYLIKMRHQYNAVYCALLSEANVLGKFEK:Sequence :HHHHHHHHHHGHTccTTcEEEccccHHHHHHHHTTTTccccEEETcTTcEEccccccccc:Sec Str :============================================================:RP:SCP|235->336,440->611|2g39A2|5e-37|26.5|225/274|c.124.1.2 :============================================================:BL:SWS|196->338,440->609|CAT2_CLOK5|1e-11|31.4|263/429 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|204->280|PF04223|8e-04|35.1|77/463|CitF 301: . . . . + .: 360 :MIHNVGGNEPFKEGLYATSEMFVDGFMQLYRSGILKRKVYPHETLQRLLNENKLSHQISP:Sequence :cccEEccHHHHHHHHTTcccEEEEEccEEETTcccTTHHHHHHHEHHTTTcEEEEEEcEE:Sec Str :==================================== :RP:SCP|235->336,440->611|2g39A2|5e-37|26.5|225/274|c.124.1.2 :====================================== :BL:SWS|196->338,440->609|CAT2_CLOK5|1e-11|31.4|263/429 361: . . . * . .: 420 :AALTRLIEEKIIHPQLSEKEVTLLQQWGIFKMELKYQNGFIYPPNEIPIPADLADSQSAE:Sequence :EcTTcccTTTEEEcGGGccEEEEcTTccccTTcccccHHHHTccccccccHHHHHHHHHH:Sec Str 421: . . + . . .: 480 :KIYRHCLEPHIKGGHLLHASFFLGPQRFYNFLRGLKKEEREQFCMKRVAYVNQLYGSEEL:Sequence :TTccTTcEEEcccccTTcEEcEEccHHHHHHHTEEcTTTcTTEEEccHHHHTcHHHHHHH:Sec Str : =========================================:RP:SCP|235->336,440->611|2g39A2|5e-37|26.5|225/274|c.124.1.2 : =========================================:BL:SWS|196->338,440->609|CAT2_CLOK5|1e-11|31.4|263/429 481: . * . . . .: 540 :KRLQRKDARFLNSALMVTLNGAIISDKLEDGRTVSGVGGQYNFVAMAHALVDARSIIMLR:Sequence :HHHTTcccEEEEcccEEETTccEEcccTTTccccccccTHHHHHHHHHHcTTcEEEEccc:Sec Str :============================================================:RP:SCP|235->336,440->611|2g39A2|5e-37|26.5|225/274|c.124.1.2 :============================================================:BL:SWS|196->338,440->609|CAT2_CLOK5|1e-11|31.4|263/429 541: + . . . . *: 600 :SVREKHGEIHSNIIWNYGHTTIPCHLRDMVVTEYGIANLRGKNDREIIIALLNITDSRFQ:Sequence :EETTTTEEcEEccccTTccEEEcTTTccEEEETTEEEEcTTccHHHHHHHHHTTccHHHH:Sec Str :============================================================:RP:SCP|235->336,440->611|2g39A2|5e-37|26.5|225/274|c.124.1.2 :============================================================:BL:SWS|196->338,440->609|CAT2_CLOK5|1e-11|31.4|263/429 601: . . . . + .: 660 :DFLLREAQKAGKISKNYQIPDDFKDNYPARLKKHLRPYKDQGYLPEFPFGTEFTPEEIAL:Sequence :HHHHHHHHHHcEEEEEEEEccc :Sec Str : XXXXXXXXXXXXX :SEG|645->657|pefpfgteftpee :=========== :RP:SCP|235->336,440->611|2g39A2|5e-37|26.5|225/274|c.124.1.2 :========= :BL:SWS|196->338,440->609|CAT2_CLOK5|1e-11|31.4|263/429 661: . . . * . .: 720 :TKAFEAIQTMIAKKRFPIPNKHQLRAILSAPEIATPYLQRLQLDKPTTMKDKLMQKLVLY:Sequence : :Sec Str 721: . . + . . .: 780 :GLSQTGAM :Sequence : :Sec Str