[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABA58385.1 noce0 ABA58385.1 "Abortive infection protein"
MNRRQAWIDIIFALILVGVSAIAVGLISAFMGQHQFFLLLALQGIAILLGLRFLLAVRGQ
SWRHLGLQVLTLKDLGRALIGFVSCMGANMVLTTLVFITDTQSLKQHVDALKIIGTQLSS
EISFAGIAALMFFVGVYEEIMARGFLLARCRLALGGLWGPVLLSSFLFGLGHLYQGWIGV
AQTTLFGIVLAILTVRWGTLWPAIFAHAMLNIFSLAILEQFAEQSSFSIFQF
//