[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA58417.1"

            "O-antigen polymerase"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------1---1--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------1------1------------------------------111------------------------------------------------1----11------------111111-----------------1---1-1----1-----------------------------------1---------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------111------11------------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPFRDILITGVIFALLPVCFLRPWIGILVWTWISIMNPHRLTWGFAWDMPFAQLVAIAIL:Sequence 61: . . . * . .: 120 :GGMLLVRDRKSIAWTPELRLLLVLFGYMTFTTFFAWAPDAAWQQWDKVAKIFLMSYVTTI:Sequence : XXXXXXXXXXXX :SEG|95->106|awapdaawqqwd 121: . . + . . .: 180 :LIYGKQRIYWLLLVATLSLGFYGFKGGLFTILTGGQFHVMGPPKSFLAGNNFLGLAMVMG:Sequence 181: . * . . . .: 240 :LPLLLVFAQQEARVWFRRLLYATFALTFIAVPFTYSRGAMLGLAVVSVLLFMRWRNKALL:Sequence : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|202->346|PF04932|4e-06|37.8|143/159|Wzy_C 241: + . . . . *: 300 :VIMLIPILFGGLAFVPEKLFNRAESIQNYEMDASSMQRIAAWDLAWNIAIDRPLRGGGFE:Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|202->346|PF04932|4e-06|37.8|143/159|Wzy_C 301: . . . . + .: 360 :YEGDTARWHTYLDPKYYYVMEGAHVAHSIYFQMLGQHGFVGLSLFMIILFLTYRRLGRLK:Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|202->346|PF04932|4e-06|37.8|143/159|Wzy_C 361: . . . * . .: 420 :KWTLEISDLRWIGQYAWALRVGLVGYAVTGAFLNLAYFDLYYLFVVLAALLWREALSDER:Sequence : XXXXXXXXXXXX :SEG|400->411|lyylfvvlaall 421: . . + . . .: 480 :IASRRSATAFTGKGVRSDWHPPPRVGKGSFSSKSQSESFPEESSGRHL :Sequence : XXXXXXXXXXXXXXXXXXXX :SEG|446->465|gkgsfssksqsesfpeessg