[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABA58417.1 noce0 ABA58417.1 "O-antigen polymerase"
MPFRDILITGVIFALLPVCFLRPWIGILVWTWISIMNPHRLTWGFAWDMPFAQLVAIAIL
GGMLLVRDRKSIAWTPELRLLLVLFGYMTFTTFFAWAPDAAWQQWDKVAKIFLMSYVTTI
LIYGKQRIYWLLLVATLSLGFYGFKGGLFTILTGGQFHVMGPPKSFLAGNNFLGLAMVMG
LPLLLVFAQQEARVWFRRLLYATFALTFIAVPFTYSRGAMLGLAVVSVLLFMRWRNKALL
VIMLIPILFGGLAFVPEKLFNRAESIQNYEMDASSMQRIAAWDLAWNIAIDRPLRGGGFE
YEGDTARWHTYLDPKYYYVMEGAHVAHSIYFQMLGQHGFVGLSLFMIILFLTYRRLGRLK
KWTLEISDLRWIGQYAWALRVGLVGYAVTGAFLNLAYFDLYYLFVVLAALLWREALSDER
IASRRSATAFTGKGVRSDWHPPPRVGKGSFSSKSQSESFPEESSGRHL
//