[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA58418.1"

            "AMP-dependent synthetase and ligase"
            ""

OrgPattern 44-2--7FIHIHHHEB1164532HB55411493221--333217566943433----1---232---- 46A6f874445C6AaqZKK-Ke44olKKKKKMkglhfy**1ZEZ3-15295-94A87B--UPH3cFdYJcB1-11111-398F123325522-2--1---19--2I-2341------11111111222342222429BBCD111c899F4EEE11222113113215JAW411112112111285565--3D9QDDEDEJAGDEEFGJC68EEHLDEIBJDEC45222323W43666666666666666454621212212121132222121233222111212115411111111111111111111111111112211121---62222622122I288------71-82171CB5262--B31111-11924KAAE-1--178ZQd535XRYQL22222222234-BAEB9MBA9KH-A99C78896D98DH6A5B9J38659BG2222222293114A74----------111111111111111----1EGXD-7KJBHHNPPQQRHKKFGGKTYYYXDVUDdUejV23GGD9BDCASBIKTM11A1122A22222222346E784eJB6558797446-4975824467997dN993222-222212-1--------1216119A15878375343444C9666666653667--11862------D7KB765766E7FFA76-579788A7A96AA777777768DBRS57666777777767667946566761-476767544565---312231665556S39222131-22212112778972657894JNILRNIHBFCEF8JIP4333333332244C788885334465544442222222----112222222112121-------------------------------------1A1 ----995-532-A9EQOQISSeShgdkIJJLEJQXNPLHKJLLHGGKDIcSVSWHGNHECBCE2323342321422111112223244-GHBOEH9332355EHIG2997O8F797A8144584OB2A4W*F-CCM7743A549655631A21J9998EBAIBYBM7MBXQEFFF2224f887B5ROSuSaQ65OEGA9 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSRIHSANSLVHSLVLDNALKGPDASALVHGDQTLTYASLGETVEACARGLLALGLASSE:Sequence :ccEEcHHHTHHHHHHHHHHHHHHHHTcEEETccEEEHHHHHHHHHHHHHHHHHTccTTcE:Sec Str : XXXXXXXXXXXXXXXX:SEG|45->61|eacargllalglasser : ==================================================:RP:SCP|11->524|1md9A|4e-72|21.3|493/536|e.23.1.1 : ============================================:BL:SWS|17->524|LCFB_BACSU|4e-54|29.6|494/513 : $$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|36->449|PF00501|6e-57|38.0|387/405|AMP-binding 61: . . . * . .: 120 :RVAIYLPKRPETVVTLFGAAAAGGVFVPINPLLKPRQVAHILRDCNVRVLVTASNRIDFL:Sequence :EEEEEccccTTTHHHHHHHHHHTcEEEEEcTTccHHHHHHHHHHHcccEEEEcTTTHHHH:Sec Str :X :SEG|45->61|eacargllalglasser : XXXXXXX :SEG|78->84|gaaaagg :============================================================:RP:SCP|11->524|1md9A|4e-72|21.3|493/536|e.23.1.1 :============================================================:BL:SWS|17->524|LCFB_BACSU|4e-54|29.6|494/513 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|36->449|PF00501|6e-57|38.0|387/405|AMP-binding 121: . . + . . .: 180 :QDALAECHDLRSLVIVDAPTQTIEKLAQPMAISWERLLSLGTTQQSPGHRRIDSDMAAIL:Sequence :HHHHHHcTTccEEEETTcccccTTcccHHHHHHHTccTTccGGGcccccccTTTcEEEEE:Sec Str : ##:PROS|179->190|PS00455|AMP_BINDING|PDOC00427| :============================================================:RP:SCP|11->524|1md9A|4e-72|21.3|493/536|e.23.1.1 :============================================================:BL:SWS|17->524|LCFB_BACSU|4e-54|29.6|494/513 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|36->449|PF00501|6e-57|38.0|387/405|AMP-binding 181: . * . . . .: 240 :YTSGSTGRPKGVVLSHRNLVAGAQSVAQYLENNSNDRLLAVLPLSFDAGFSQLTTAFSVG:Sequence :cccccccccccEEEEHHHHHHHHHHHTccccccTTcEEEEcccTTcHHHHHHHHHHHHHT:Sec Str :########## :PROS|179->190|PS00455|AMP_BINDING|PDOC00427| :============================================================:RP:SCP|11->524|1md9A|4e-72|21.3|493/536|e.23.1.1 :============================================================:BL:SWS|17->524|LCFB_BACSU|4e-54|29.6|494/513 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|36->449|PF00501|6e-57|38.0|387/405|AMP-binding 241: + . . . . *: 300 :ASVVLMEYLLPKDVIKSITRHGITGITAVPPLWVQLASLAWPPEAADTLRYIANTGGRMP:Sequence :cEEEEcccccHHHHHHHHHHTTccEEEEcGGGHHHHHHccGGGcccTTccEEEEEccccc:Sec Str :============================================================:RP:SCP|11->524|1md9A|4e-72|21.3|493/536|e.23.1.1 :============================================================:BL:SWS|17->524|LCFB_BACSU|4e-54|29.6|494/513 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|36->449|PF00501|6e-57|38.0|387/405|AMP-binding 301: . . . . + .: 360 :KAATTALRRSLPQTKVFLMYGLTEAFRSTYLPPEEVDKRPDSIGKAIPNVEIQVAREDGS:Sequence :HHHHHHHHHHTTccccEEEEEcGGGccEEEEccTTccccTTcccEEcTTcEEEEEcTTTc:Sec Str :============================================================:RP:SCP|11->524|1md9A|4e-72|21.3|493/536|e.23.1.1 :============================================================:BL:SWS|17->524|LCFB_BACSU|4e-54|29.6|494/513 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|36->449|PF00501|6e-57|38.0|387/405|AMP-binding 361: . . . * . .: 420 :LCLPGESGELVHRGVLVAMGYWNDPKKTAERFRPTPGQPPELPLTEIAVWSGDTVRMDED:Sequence :cccTTccEEEEEEcTTcccEETTcHHHHHHHccTTEEETEEcTETTccEEEEEEEEEcTT:Sec Str :============================================================:RP:SCP|11->524|1md9A|4e-72|21.3|493/536|e.23.1.1 :============================================================:BL:SWS|17->524|LCFB_BACSU|4e-54|29.6|494/513 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|36->449|PF00501|6e-57|38.0|387/405|AMP-binding 421: . . + . . .: 480 :GFFYFIGRQDEMIKTSGYRVSPTEVEEVLYQAGLVAEAAVVGVLHPKLGQGIVAIVKPNK:Sequence :ccEEEEEEGGGccccTTccccHHHHHHHHHTcTTEEEEEEEEEEETTTEEEEEEEEcTTc:Sec Str : XXXXXXXXXXXXX :SEG|452->464|aglvaeaavvgvl :============================================================:RP:SCP|11->524|1md9A|4e-72|21.3|493/536|e.23.1.1 :============================================================:BL:SWS|17->524|LCFB_BACSU|4e-54|29.6|494/513 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|36->449|PF00501|6e-57|38.0|387/405|AMP-binding 481: . * . . . .: 540 :DNFDPEDLLATCRAELPNFMVPLAVIVSENLPRNTNGKIDRRALAMEFELLFKEQTAP :Sequence :cccHHHHHHHHHTTccGGGccTTcEEEcccccccTTccccHHHHHHHHHcHHTccEEE :Sec Str :============================================ :RP:SCP|11->524|1md9A|4e-72|21.3|493/536|e.23.1.1 :============================================ :BL:SWS|17->524|LCFB_BACSU|4e-54|29.6|494/513