[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA58420.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------11---1-1111---1-------------------------2----13--------1-----------------------------------------2--11111--------------------------------1-----------------------------------------------------------------------------------------------1----2--1-11----111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1---1--------------11--11----------------1---1-----------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVKRVLMIAYHFPPASGSSGMQRTLSFSRDLPEHDWQPIILSIYPRAYERRCDDQLADIG:Sequence : EEEEEcTTccTTcccccHHHHHHHHHHHHHTTcEEEEEEEcccGGGccEEEEEEccc:Sec Str : ==========================================================:RP:SCP|3->373|1f0kA|3e-04|18.9|307/351|c.87.1.2 61: . . . * . .: 120 :SETIVYRAFGLDTARHLALGGRYSRFLALPDRWVSWWLGAVPAGLRLIRRYRPQVLWSTY:Sequence :cEEEEEEEEEETTEEEEEEcccccccccGGGGGHGGHHHHHHHHHHHHHHHTccccEEEE:Sec Str :============================================================:RP:SCP|3->373|1f0kA|3e-04|18.9|307/351|c.87.1.2 121: . . + . . .: 180 :PIATAHLIGLTLHRLSGIPWIADFRDSMTEDNYPSNPRVRRAYRAVEAATVHRCTRAIFT:Sequence :EHHHHHHHHHHHHHHHTccEEEEccccHcHHHcccccHHHHHHHHHHHHHHHHccEEEEc:Sec Str : XXXXXXXXXXXXXX :SEG|158->171|rvrrayraveaatv :============================================================:RP:SCP|3->373|1f0kA|3e-04|18.9|307/351|c.87.1.2 181: . * . . . .: 240 :APGAVRMYAERYPERSDKTWVLIENGYEDSIFDTVSLPSLRDSPRPFRLVHSGVVYPNER:Sequence :cHHHHHHHHHHHcccGGGEEEEccccccTTTcccccHHHTTcccccEEEEEEccccG GG:Sec Str :============================================================:RP:SCP|3->373|1f0kA|3e-04|18.9|307/351|c.87.1.2 241: + . . . . *: 300 :DPRAFFEALASLKRSGQITAQSLQVVFRASGSEDYFRQLLREWGIDDIVHFEPHIPYRGA:Sequence :cHHHHHHHHHHHHHcGGGHcTTccEEEEEEccccHHHHHHHHTTcTTTEEEEccccHHHH:Sec Str :============================================================:RP:SCP|3->373|1f0kA|3e-04|18.9|307/351|c.87.1.2 301: . . . . + .: 360 :LAEMLTADGLLILQASNCNHQIPAKLYEYLRARRPILGLTDSEGDTARVLRQAGIETVAP:Sequence :HHHHHHccEEEEEEcccccccccHHHHHHHHTTccEEEEEccTTHHHHccTTTcE EEEc:Sec Str :============================================================:RP:SCP|3->373|1f0kA|3e-04|18.9|307/351|c.87.1.2 361: . . . * . .: 420 :LDSAAAITATLQDFLKQLQDGTAPVASEAEIARSSRRSRVASLAECLEETIATDLNFER :Sequence :TTcHHHHHHHHHHHHTT :Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|386->405|aseaeiarssrrsrvaslae :============= :RP:SCP|3->373|1f0kA|3e-04|18.9|307/351|c.87.1.2