[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABA58420.1 noce0 ABA58420.1 "hypothetical protein"
MVKRVLMIAYHFPPASGSSGMQRTLSFSRDLPEHDWQPIILSIYPRAYERRCDDQLADIG
SETIVYRAFGLDTARHLALGGRYSRFLALPDRWVSWWLGAVPAGLRLIRRYRPQVLWSTY
PIATAHLIGLTLHRLSGIPWIADFRDSMTEDNYPSNPRVRRAYRAVEAATVHRCTRAIFT
APGAVRMYAERYPERSDKTWVLIENGYEDSIFDTVSLPSLRDSPRPFRLVHSGVVYPNER
DPRAFFEALASLKRSGQITAQSLQVVFRASGSEDYFRQLLREWGIDDIVHFEPHIPYRGA
LAEMLTADGLLILQASNCNHQIPAKLYEYLRARRPILGLTDSEGDTARVLRQAGIETVAP
LDSAAAITATLQDFLKQLQDGTAPVASEAEIARSSRRSRVASLAECLEETIATDLNFER
//