[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA58511.1"

            "Transposase"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------15K-----------Q-----3--------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------G----------------------------------------------------------------------------------------------P------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MMRCSIDLRKRVIDFVRGGGSKAEAARRFQVGRASIYRWLSQDDALCYERPGPRRSHKLD:Sequence : HHHHHHHHHHTTcccHHHHHHHHTccHHHHHHHHHH :Sec Str : ====================================================== :RP:SCP|5->58|1pdnC|7e-04|16.7|54/123|a.4.1.5 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->103|PF01710|2e-14|48.5|99/114|Transposase_14 61: . . . * . .: 120 :WEALRVHVEDKAALTYKERARHFGVSYYCIWHAMHKMGLTRKKNDGVHAAL :Sequence : :Sec Str :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|5->103|PF01710|2e-14|48.5|99/114|Transposase_14