[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA58524.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------7----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEIGLWSFAMTDVDFVPTKPHQPGEFALQWVPRAGHDLARKALGWVSPSTRITSPPTEGR:Sequence : ===========================:BL:SWS|34->76|MED16_XENLA|1e-04|34.9|43/697 61: . . . * . .: 120 :SRYWQRENHSANSWKNASNLALARSLGGRSPSMENSNVSS :Sequence :================ :BL:SWS|34->76|MED16_XENLA|1e-04|34.9|43/697