[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABA58524.1 noce0 ABA58524.1 "hypothetical protein"
MEIGLWSFAMTDVDFVPTKPHQPGEFALQWVPRAGHDLARKALGWVSPSTRITSPPTEGR
SRYWQRENHSANSWKNASNLALARSLGGRSPSMENSNVSS
//