[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA58609.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111-11111--------------1--1--1---------------11---------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTEKTGKSLRKPSSSSEVDAFLKKVAAMPQIKPGSRHGRLIFAMDATASREPTWDRACHI:Sequence : cccEEEEEEEEccTTcHHHHHHHHHH:Sec Str : =====================:RP:SCP|40->206|1shtX|2e-04|13.6|162/177|c.62.1.1 61: . . . * . .: 120 :QAQMFQETASLGGLEIQLCYYRGFKEFSASSWLRHSDALLKQMNTVACRGGYTQIEKALQ:Sequence :HHHHHHHTccTTEEEEEEEEcccEEEEEcHHHHHHHccHHHHGGGcccccccccHHHHHH:Sec Str :============================================================:RP:SCP|40->206|1shtX|2e-04|13.6|162/177|c.62.1.1 121: . . + . . .: 180 :HTQNETRKQKVNALVFVGDCMEEKMERLCHMAGELGILGVPAFVFQEGYDLVAERAFRQI:Sequence :HHGGTccTTcEEEEEEEEcccccccccccGGGTTcEEEEEEETTTEETTcHHHHHHHHHH:Sec Str :============================================================:RP:SCP|40->206|1shtX|2e-04|13.6|162/177|c.62.1.1 181: . * . . . .: 240 :AQLTQGAYCRFDAASAAQLRDLLNAVAVYATGGRAALENFSQRQGGVTLRLIHQIKKD :Sequence :ccccHHHHHEEEEccGGGHHHHHHHH :Sec Str :========================== :RP:SCP|40->206|1shtX|2e-04|13.6|162/177|c.62.1.1