[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABA58609.1 noce0 ABA58609.1 "conserved hypothetical protein"
MTEKTGKSLRKPSSSSEVDAFLKKVAAMPQIKPGSRHGRLIFAMDATASREPTWDRACHI
QAQMFQETASLGGLEIQLCYYRGFKEFSASSWLRHSDALLKQMNTVACRGGYTQIEKALQ
HTQNETRKQKVNALVFVGDCMEEKMERLCHMAGELGILGVPAFVFQEGYDLVAERAFRQI
AQLTQGAYCRFDAASAAQLRDLLNAVAVYATGGRAALENFSQRQGGVTLRLIHQIKKD
//