[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA58618.1"

            "Flagellar biosynthesis protein FlhA"
            ""

OrgPattern -------------------------------------------------------------------- 1111------------------------------------1---1---1----1--------1-1------------------11111--------------------1-222222222222221--------------------1---------------------------------------------11111111-111111111111111111111111111111111------------------------------------------------------------------------------------------12111111111111111111---111--111111111111111111-1--11111111----1131111112112--11--11111-2222212222112111223111111-1111112222111--------1111-121--------------------------------111121123222532333122214445141222111--112112111--121111211141-------111111111-1111111222211111111122122-1-1111-1111111111111111111---13-111111111312131211121122221---11-111111121122131442122222-4212222222423221112---2132233233333333333331111211241333345524343--2------1111--411-------------------------1122121111311111232---------1111211111341111122222223------111111111111111111--------------------------1-11111111-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1--------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNTAAVRGHLREVGRNGLGAPLLLLLMLAMMVLPLPAALLDLLFTFNISLALVVLLAGVY:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|18->43|lgaplllllmlammvlplpaalldll : XXXXXXXX :SEG|50->57|lalvvlla : ==============:BL:SWS|47->689|FLHA_PROMI|e-159|53.0|638/696 : $$$$$$$$$$$$$$$:RP:PFM|46->682|PF00771|0.0|53.0|632/656|FHIPEP 61: . . . * . .: 120 :ARRPLDFSSFPTILLLATLMRLALNVASTRVVLLEGHTGSDAAGKVIQAFGEFVIGGNYA:Sequence : :Sec Str : XXXXXXXXXXX :SEG|74->84|lllatlmrlal :============================================================:BL:SWS|47->689|FLHA_PROMI|e-159|53.0|638/696 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|46->682|PF00771|0.0|53.0|632/656|FHIPEP 121: . . + . . .: 180 :VGLVVFFILVLINFVVVTKGATRISEVSARFTLDAMPGKQMAIDADLNAGLIDQEEARLR:Sequence : :Sec Str :XXXXXXXXXXXXXXXXX :SEG|121->137|vglvvffilvlinfvvv : ######################## :PROS|143->166|PS00994|FHIPEP|PDOC00763| :============================================================:BL:SWS|47->689|FLHA_PROMI|e-159|53.0|638/696 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|46->682|PF00771|0.0|53.0|632/656|FHIPEP 181: . * . . . .: 240 :REEVMQEADFYGSMDGAGKFVRGDAIAGILILLINVAGGLAVGLLQHDLSFSEAARNYTL:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXX :SEG|203->221|gdaiagilillinvaggla :============================================================:BL:SWS|47->689|FLHA_PROMI|e-159|53.0|638/696 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|46->682|PF00771|0.0|53.0|632/656|FHIPEP 241: + . . . . *: 300 :LTIGDGLVAQIPSLVLSTAAGILVTRVSHAQDMGSQILAQLFKNPKSLAVVAVVLGSMGL:Sequence : :Sec Str :============================================================:BL:SWS|47->689|FLHA_PROMI|e-159|53.0|638/696 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|46->682|PF00771|0.0|53.0|632/656|FHIPEP 301: . . . . + .: 360 :IPGMPNLAFLGLALLCGFGVWWLGKRQKAEVAPTPPMAAPSETPELSWEDIPPVDPIGLE:Sequence : HHHHHHHHTccccccccccccGGGcEEEEcTTTccEEEEE:Sec Str : XXXXXXXXXXXXX :SEG|307->319|laflglallcgfg :============================================================:BL:SWS|47->689|FLHA_PROMI|e-159|53.0|638/696 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|46->682|PF00771|0.0|53.0|632/656|FHIPEP 361: . . . * . .: 420 :VGYRLIPLVDKTQGGQLMGRIKGVRKKLSQDWGFLIPPVHIRDNLNLAPIAYRITLFGVT:Sequence :EccTTEEEEEcccccEEEEEEETTEEEccEEETTEEEEEEGGGTEEEEccccccTTcE E:Sec Str :============================================================:BL:SWS|47->689|FLHA_PROMI|e-159|53.0|638/696 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|46->682|PF00771|0.0|53.0|632/656|FHIPEP 421: . . + . . .: 480 :VGEAEVFPEREMAINPGQVFGKVEGTPAQDPAFGLEALWIEPAQREQAQMHGYTVVDAGT:Sequence :EEcccTTccccccGGGcccccccccTTcccccccccEEEEEEccccccccEcccccEEEE:Sec Str :============================================================:BL:SWS|47->689|FLHA_PROMI|e-159|53.0|638/696 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|46->682|PF00771|0.0|53.0|632/656|FHIPEP 481: . * . . . .: 540 :VIATHLSQILQNHAHGLLGREEVQKLLENLAKTAPKLVEGLVPEILPLSIVQKVLQQLLE:Sequence :EEEccccTTccccccEEEcTTTEETTEEEEccHHHEccTTTcEEEccccEEEcccHHHHH:Sec Str : ============================================:RP:SCP|497->588|1w7pD2|4e-16|15.4|91/117|a.4.5.54 :============================================================:BL:SWS|47->689|FLHA_PROMI|e-159|53.0|638/696 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|46->682|PF00771|0.0|53.0|632/656|FHIPEP 541: + . . . . *: 600 :EGVPIRDMRTIVESLTEHGLRSQDPAILTAIIRIALGRFIIQCFNGLEKELQVISIAPAL:Sequence :HHHHHHHHHTccTTccTTGGGTcGGGccTTEEEEEEEEEEEcccTTcEcHHHEEEcccEE:Sec Str :================================================ :RP:SCP|497->588|1w7pD2|4e-16|15.4|91/117|a.4.5.54 :============================================================:BL:SWS|47->689|FLHA_PROMI|e-159|53.0|638/696 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|46->682|PF00771|0.0|53.0|632/656|FHIPEP 601: . . . . + .: 660 :EQLLLASLQTASEGGGLNMEPGLAEKLHLTLRDSVQRQEAAGKPAILLVQGVLRPWLARF:Sequence :cccEEccGGGcHHH :Sec Str :============================================================:BL:SWS|47->689|FLHA_PROMI|e-159|53.0|638/696 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|46->682|PF00771|0.0|53.0|632/656|FHIPEP 661: . . . * . .: 720 :VRHAIPELKVLSYNEIPEDKQVRIVASVGS :Sequence : :Sec Str :============================= :BL:SWS|47->689|FLHA_PROMI|e-159|53.0|638/696 :$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|46->682|PF00771|0.0|53.0|632/656|FHIPEP