[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABA58618.1 noce0 ABA58618.1 "Flagellar biosynthesis protein FlhA"
MNTAAVRGHLREVGRNGLGAPLLLLLMLAMMVLPLPAALLDLLFTFNISLALVVLLAGVY
ARRPLDFSSFPTILLLATLMRLALNVASTRVVLLEGHTGSDAAGKVIQAFGEFVIGGNYA
VGLVVFFILVLINFVVVTKGATRISEVSARFTLDAMPGKQMAIDADLNAGLIDQEEARLR
REEVMQEADFYGSMDGAGKFVRGDAIAGILILLINVAGGLAVGLLQHDLSFSEAARNYTL
LTIGDGLVAQIPSLVLSTAAGILVTRVSHAQDMGSQILAQLFKNPKSLAVVAVVLGSMGL
IPGMPNLAFLGLALLCGFGVWWLGKRQKAEVAPTPPMAAPSETPELSWEDIPPVDPIGLE
VGYRLIPLVDKTQGGQLMGRIKGVRKKLSQDWGFLIPPVHIRDNLNLAPIAYRITLFGVT
VGEAEVFPEREMAINPGQVFGKVEGTPAQDPAFGLEALWIEPAQREQAQMHGYTVVDAGT
VIATHLSQILQNHAHGLLGREEVQKLLENLAKTAPKLVEGLVPEILPLSIVQKVLQQLLE
EGVPIRDMRTIVESLTEHGLRSQDPAILTAIIRIALGRFIIQCFNGLEKELQVISIAPAL
EQLLLASLQTASEGGGLNMEPGLAEKLHLTLRDSVQRQEAAGKPAILLVQGVLRPWLARF
VRHAIPELKVLSYNEIPEDKQVRIVASVGS
//