[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA58626.1"

            "Flagellar basal body-associated protein FliL"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1--------------------------------------------------------------11-222---1--1------------1-------1122--------------------------------------------------------------------------------------------------------2-1--------------------------122222112122222111-------------------111--1111111------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAESSTLDAETRNGGGSKKSLIILICALIILLIIAVAGALYLTGVIGPQAVTGEVSADAA:Sequence : HHHHHH:Sec Str : XXXXXXXXXXXXXXXXXXXXXX :SEG|21->42|liilicaliilliiavagalyl : $$$$$$$$$$$$$$$$$:RP:PFM|44->171|PF03748|1e-15|40.0|120/149|FliL 61: . . . * . .: 120 :RTNQPAIYHSLDPAFVVNFQHQSQHRIRFLQTKMEAMARDQEVIEALQTHMPAIRNTLLL:Sequence :HH HTTccGG GccccccHHHHHHHHHHHHHTTcccTTccc :Sec Str : ======================================================:BL:SWS|67->171|FLIL_AQUAE|8e-10|33.3|99/161 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|44->171|PF03748|1e-15|40.0|120/149|FliL 121: . . + . . .: 180 :LLSQQDYETMRTVEGKERLREAAREEINLILEAQAAVSGVEAVFFTGFVMQ :Sequence : :Sec Str :=================================================== :BL:SWS|67->171|FLIL_AQUAE|8e-10|33.3|99/161 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|44->171|PF03748|1e-15|40.0|120/149|FliL