[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABA58626.1 noce0 ABA58626.1 "Flagellar basal body-associated protein FliL"
MAESSTLDAETRNGGGSKKSLIILICALIILLIIAVAGALYLTGVIGPQAVTGEVSADAA
RTNQPAIYHSLDPAFVVNFQHQSQHRIRFLQTKMEAMARDQEVIEALQTHMPAIRNTLLL
LLSQQDYETMRTVEGKERLREAAREEINLILEAQAAVSGVEAVFFTGFVMQ
//