[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA58831.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- 3331------------------------------------1---1---1--1-1--------1-1------------------33333--------------------3------------------------------------3---------------------------------------------333222222221222222333323222333333322222233------------------------------------------------------------------------------------------33333333333343433333---333--23332333333332333331--33323333----336253344733633323333332-5565536733233333433444334-3333335655233---------223-465--------------------------------333332333444733333333433336364333333--533333333--363333333363-------333-33333-3344446445433333333333-3--3-4344-4444443333333334443---36-333333333633383633363366663---333321-22263333333333333333-3633633233336233333---3333333333333333333333321223233356666666663---------3333--533-------------------------3333333333633333444---------3222522222552223333333336------333333333333333333--------------------------3-33333233-3- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------3-----1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNQALWIAKTGLDAQQTRMATISNNLANVNTTGFKRDRAVFEDLLYQTVRQPGAQSSQNT:Sequence : :Sec Str : ##################### :PROS|11->31|PS00588|FLAGELLA_BB_ROD|PDOC00508| :============================================================:BL:SWS|1->259|FLGG_ECOLI|3e-93|63.7|259/260 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|5->35|PF00460|1e-04|58.1|31/31|Flg_bb_rod 61: . . . * . .: 120 :LLPSGLMLGTGVRTVATEKLFTQGGLTQTGNSLDMAIQGRGFFQILMPDGSLAYTRDGTF:Sequence : :Sec Str : ==========:RP:SCP|111->221|1wlgA|7e-18|33.0|103/293|b.152.1.1 :============================================================:BL:SWS|1->259|FLGG_ECOLI|3e-93|63.7|259/260 121: . . + . . .: 180 :QIDANGQLVTSSGYPVQPGITIPESALSVTVGSDGIVSVLMAGDGTPIQAGNLQLADFIN:Sequence : cccEEEEEEcTTcEEEEEETTTTTGGGGGccccEEEEE:Sec Str :============================================================:RP:SCP|111->221|1wlgA|7e-18|33.0|103/293|b.152.1.1 :============================================================:BL:SWS|1->259|FLGG_ECOLI|3e-93|63.7|259/260 181: . * . . . .: 240 :PAGLQPTGNNLFKETASSGVAQTGIPGLNGIGTLVQGALEGANVNVVEELVNMIETQRAY:Sequence :cTTccEEEEEEcTTccEEEEEEcEEEEEGGGTTTcccHHHHHHHHHHHHHHHHHHHccGG:Sec Str :========================================= :RP:SCP|111->221|1wlgA|7e-18|33.0|103/293|b.152.1.1 :============================================================:BL:SWS|1->259|FLGG_ECOLI|3e-93|63.7|259/260 : $$$$$$$$$$$$$$$$$$$:RP:PFM|222->255|PF06429|8e-08|64.7|34/39|DUF1078 241: + . . . . *: 300 :EMNSKAISSTDEMLRFATQTL :Sequence :GcccEEEEccGGG :Sec Str :=================== :BL:SWS|1->259|FLGG_ECOLI|3e-93|63.7|259/260 :$$$$$$$$$$$$$$$ :RP:PFM|222->255|PF06429|8e-08|64.7|34/39|DUF1078