[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA58871.1"

            "Flavoprotein WrbA"
WRBA_NITOC  "RecName: Full=Flavoprotein wrbA;"

OrgPattern ------1-11111111-------1-----------11---11---1--11111--------------- -11-2----------11-------11-----11-----------1---------------111---3--1------------11-1-----------------1-1------------------------------11111----------------------------1-------------111-----1-1---------------112221---1---11--------2------------------------------------------------------------------------------------------------------1-112--------1-----1---1----1----------212111-----21111-111111111111111111-111112111-1-122---111-3311--1--11111-1---------111---11------------------1-------------1-1-----333433122233322222222431143212223-21-11-1111111121221--------1-231----111--1------1-1221-------121-------------------------22--1122-111-----------------------2222------1111-1-1-12122211-1111112111121111111111-111-11111111111111112--11111--111111111111---211111111111122---------------233332111121112111211111131111111121111---1111112212211322223222111------------------------------------------------2-------11- ------------1132112111111111111111111111-111111111121111111111643-2214433143333334345611-42113422221111545-1-3-----------------------------------------------------------1-----142-31-12345591421-A797- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTKLLVLYYSMYGHVETMAHAVAEGARSVEEVEVTLKRVPELMPEEIARNAGAKLAQEAP:Sequence :ccEEEEEEcccccHHHHHHHHHHHHHHTcTTcEEEEEEccccccHHHHHHTTcccccccc:Sec Str : ==========================================================:RP:SCP|3->200|2arkA1|3e-46|32.9|164/184|c.23.5.8 :============================================================:BL:SWS|1->200|WRBA_NITOC|e-114|100.0|200/200 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|13->141|PF03358|2e-21|39.4|127/149|FMN_red 61: . . . * . .: 120 :IATVDELPEYDAIIFGTPTRFGNMCAQMRNFLDQTGKHWMSGALIGKVGSVFTSTASQHG:Sequence :cccGGGGGGccEEEEEEEEETTEEcHHHHHHHTTcHHHHHHTTTTTcEEEEEEEEccccT:Sec Str :============================================================:RP:SCP|3->200|2arkA1|3e-46|32.9|164/184|c.23.5.8 :============================================================:BL:SWS|1->200|WRBA_NITOC|e-114|100.0|200/200 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|13->141|PF03358|2e-21|39.4|127/149|FMN_red 121: . . + . . .: 180 :GQETTITSFHSTLLHQGMVIVGVPYSCQALLNMNEITGGSPYGASTLADADGSRQPSENE:Sequence :THHHHHHHHHHHHHHTTcEEcccTTccGGGGcccccccccTTccEEEccTTccccccHHH:Sec Str :============================================================:RP:SCP|3->200|2arkA1|3e-46|32.9|164/184|c.23.5.8 :============================================================:BL:SWS|1->200|WRBA_NITOC|e-114|100.0|200/200 :$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|13->141|PF03358|2e-21|39.4|127/149|FMN_red 181: . * . . . .: 240 :LTIARFQGEHVAKFTKKVVE :Sequence :HHHHHHHHHHHHHHHHHHTc :Sec Str :==================== :RP:SCP|3->200|2arkA1|3e-46|32.9|164/184|c.23.5.8 :==================== :BL:SWS|1->200|WRBA_NITOC|e-114|100.0|200/200