[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA58880.1"

            "Ferric-uptake regulator"
            ""

OrgPattern -------------------------------------------------------------------- -------1-------------1----------------11---2---1-------------1----1-1------111----1--111------------------------------------------------11111---111--------------1----------1-----1--1-------------------------------------11--11-------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111211111111111111-11111211111-1111111111111111111111111111111111111111111------------------------------1111111111111111111111122111111112--------------1-------1----111111111---------------------1-------------------------------------------111-1211211----------1--------1-11111------21111111111111111-1111111111111111111112111111111111111111111111111111-11111111111111-------111111311---------------11111111111111111111111111111111111111-111111111111-111111111111111--1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSHTNILVPFKGPSHDHWRCIRNALAVAEKTCASRGLRLTKLRRRVLELIWDRHEPAKAY:Sequence : TcTcccccHHHHHHHHHHHHcTTTEEHH:Sec Str : =================================:RP:SCP|28->159|1mzbA|2e-22|19.1|131/133|a.4.5.42 : ====================================:BL:SWS|25->160|ZUR_SHIFL|3e-26|44.1|136/171 : $$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|36->153|PF01475|4e-16|35.0|117/120|FUR 61: . . . * . .: 120 :DILEQLRQEHQAAAPPTVYRALDFLLQTGLIHRVETLNAYVGCGDPDRLHIGQFLLCRRC:Sequence :HHHHHcHHHcTTccHHHHHHHHHHHHHTTcEEEcccTTEEEEccccccccHHHHHHTccc:Sec Str :============================================================:RP:SCP|28->159|1mzbA|2e-22|19.1|131/133|a.4.5.42 :============================================================:BL:SWS|25->160|ZUR_SHIFL|3e-26|44.1|136/171 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|36->153|PF01475|4e-16|35.0|117/120|FUR 121: . . + . . .: 180 :GTVAELDAPEITGIITREAKYLGFRVDRQTVEIRGLCPQCSGD :Sequence :ccEEEccEEccHHHHHHHHHHTccccccccccEEEccTTTH :Sec Str :======================================= :RP:SCP|28->159|1mzbA|2e-22|19.1|131/133|a.4.5.42 :======================================== :BL:SWS|25->160|ZUR_SHIFL|3e-26|44.1|136/171 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|36->153|PF01475|4e-16|35.0|117/120|FUR