[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA58884.1"

            "Superoxide dismutase"
            ""

OrgPattern 11----1111111111-1--1---12221221--1--------2--111-111--------111--12 111--11111111121111-1-1112111111-1111211-111112-111111111111---11121211-----------111-111111-1111--112211312121111111111111111111111112111111--12121222221111----1111222231------------11111---122333333333333333322222333222111111111131122222222222222111111---11-----------1-----11111111111111111111111111111111111111111111111-1-12222222222211222111111--2--1122-211-1-1------1211122111111112111121212211111111112-111113111111133111111111211211111111111111111111111112111111111111111111111111111111-11221122221111111111111111111111511111-111111211212121111211121-1111111111112---1-31-1-111-1-1-11---111111121111111111111111111112-----2211111211111111111111111111111-1111111-11121111212222222222-222222222222222222222211212222222222222222222222222112222222222221111111111111211211111111111111111111113111122222222212222122211111111111112222222222233232333332222---111----11111111--11112-----------------------1-------221 2211221-B45-3B223222333332333332322222222222321233333323233222212-1111112121111112221123-4533333111111321211242131112111-13111111483-3131-1111111111--2111111121112311111331233367171115633863732442212 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTHRLPELPYALNALEPHISQETLEYHYGKHHQTYVDKLNGLVPGTEFENASLEEIITKA:Sequence :cccccccccccTTTTTTTccHHHHHHHHHTHHHHHHHHHHHHHTTcTTTTccHHHHHHHc:Sec Str : ========================================================:RP:SCP|5->108|2hc5A1|1e-32|12.9|101/109|d.352.1.1 :============================================================:BL:SWS|1->191|SODF_LEGPH|1e-84|70.2|191/192 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->82|PF00081|4e-23|62.8|78/82|Sod_Fe_N 61: . . . * . .: 120 :SGTLFNNGAQVWNHTFYWNCLTPQGGGEPSGALLEAIEKNFGSFSDFKEKFSQSATTLFG:Sequence :cHHHHHHHHHHHHHHHHHHTccTTccccccTHHHHHHHHHHccHHHHHHHHHHHHHHccc:Sec Str :================================================ :RP:SCP|5->108|2hc5A1|1e-32|12.9|101/109|d.352.1.1 : ====================================:RP:SCP|85->192|1ap5A2|1e-32|47.2|108/115|d.44.1.1 :============================================================:BL:SWS|1->191|SODF_LEGPH|1e-84|70.2|191/192 :$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|5->82|PF00081|4e-23|62.8|78/82|Sod_Fe_N : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|88->187|PF02777|2e-36|65.0|100/104|Sod_Fe_C 121: . . + . . .: 180 :SGWAWLVKNSDGSLDIVGTSNAGNPLTEGKTPLLTCDVWEHAYYIDYRNARPKYLEAFWK:Sequence :cEEEEEEEcTTccEEEEEEETTccHHHHTcEEEEEEEccGGGTHHHHTTcHHHHHHHHTT:Sec Str : ######## :PROS|157->164|PS00088|SOD_MN|PDOC00083| :============================================================:RP:SCP|85->192|1ap5A2|1e-32|47.2|108/115|d.44.1.1 :============================================================:BL:SWS|1->191|SODF_LEGPH|1e-84|70.2|191/192 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|88->187|PF02777|2e-36|65.0|100/104|Sod_Fe_C 181: . * . . . .: 240 :LANWDFVAKNLAN :Sequence :TccHHHHHHHHHH :Sec Str :============ :RP:SCP|85->192|1ap5A2|1e-32|47.2|108/115|d.44.1.1 :=========== :BL:SWS|1->191|SODF_LEGPH|1e-84|70.2|191/192 :$$$$$$$ :RP:PFM|88->187|PF02777|2e-36|65.0|100/104|Sod_Fe_C