[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA58912.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------12--------------------------------------------------------------------------------1----------------------------1-----------------------------------------------------------------------------------------------1---------111----------------------------------------------------------------------1111111111--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MHYRKQQGGMSFLGWILVLALLALVGLGIMRLFPLYMEYFSVKTSLESLVNQPDLHAMGK:Sequence : XXXXXXXXXXXXXX :SEG|16->29|ilvlallalvglgi : =================:BL:SWS|44->117|DBP7_PHANO|6e-04|33.8|68/100 61: . . . * . .: 120 :TNIRNALLRRLDINDVAHVSKENIEIIKTRRTVTVAVDYEVRTPFLGNIDLMAHFNPLIE:Sequence :========================================================= :BL:SWS|44->117|DBP7_PHANO|6e-04|33.8|68/100 121: . . + . . .: 180 :VSSP :Sequence