[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA58916.1"

            "positive regulator of sigma(E), RseC/MucC"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------11-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVEASAQVIVKSETYAWVEAERRTSCHGCTLSQGCGTGSIAKYLMIKPIMVKASNPVGAE:Sequence : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->78|PF04246|1e-11|41.3|63/135|RseC_MucC 61: . . . * . .: 120 :AGDRVIVGLPEKAFLQGSFLLYMVPLLAMLLGAGLGGTLAPHFGGNEGLEVLLGLGGLAG:Sequence : XXXXXXXXXXXXXXXXXXXXX :SEG|80->100|llymvpllamllgaglggtla : XXXXXXXXXXXXXXXXX:SEG|104->125|ggneglevllglgglaggllgv :$$$$$$$$$$$$$$$$$$ :RP:PFM|16->78|PF04246|1e-11|41.3|63/135|RseC_MucC 121: . . + . . .: 180 :GLLGVRYMRMGPDLEPKILRTVGRQR :Sequence :XXXXX :SEG|104->125|ggneglevllglgglaggllgv