[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA59023.1"

            "Ribosomal RNA methyltransferase RrmJ/FtsJ"
RRMJ_NITOC  "RecName: Full=Ribosomal RNA large subunit methyltransferase J;         EC=2.1.1.-;AltName: Full=rRNA (uridine-2'-O-)-methyltransferase;AltName: Full=23S rRNA m2U2552 methyltransferase;"

OrgPattern -----------------------111111111111111111111111111111--------111--11 ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111-111111111111111111111111111111111-11111111111111111111111111-1111--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111---------111111-1-------------------------111111111111111111111111111111111-11111111--111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------1111111111--------------------------------------- 2212332172322333333323333323323223221423244322223232312133333333333333233333333333333334-2323122323332233223435353341322322354252AL5-4561222423712222332232513324235331433A35342322G2323332332352344445 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAKRKSHSARWLREHFRDSYVIQAKAQGYRSRAVFKLQEIDTRERLLGPGRVVIDLGAAP:Sequence :ccccHHHccTTcHHHHHHHHHHHHHHTccccHHHHHHHHHHHHHccccTTcEEEEEccTT:Sec Str : =================================:RP:SCP|28->203|1eizA|8e-60|55.7|176/181|c.66.1.2 :============================================================:BL:SWS|1->212|RRMJ_NITOC|e-121|100.0|212/212 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|31->201|PF01728|2e-26|39.2|171/179|FtsJ 61: . . . * . .: 120 :GGWSQWAAERVGERGRVIAMDILPMLSCPGVQFIQGDFREDNVLAELQNTLAGCVVDLVM:Sequence :cHHHHHHHHHHcTTcEEEEEEcccccccTTEEEEEccTTcHHHHHHHHHHHTTccEEEEE:Sec Str :============================================================:RP:SCP|28->203|1eizA|8e-60|55.7|176/181|c.66.1.2 :============================================================:BL:SWS|1->212|RRMJ_NITOC|e-121|100.0|212/212 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|31->201|PF01728|2e-26|39.2|171/179|FtsJ 121: . . + . . .: 180 :SDMAPNMSGMAAVDQPRAIYLGELALAFAQESLGPEGSFLLKTFQGEGFDALYEVIRQDF:Sequence :EcccccccccHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEEccTTHHHHHHHHHHHE:Sec Str :============================================================:RP:SCP|28->203|1eizA|8e-60|55.7|176/181|c.66.1.2 :============================================================:BL:SWS|1->212|RRMJ_NITOC|e-121|100.0|212/212 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|31->201|PF01728|2e-26|39.2|171/179|FtsJ 181: . * . . . .: 240 :SRVRIHKPPASRGRSREVYIVARRSRKDNGGG :Sequence :EEEEEEccTTccTTccEEEEEEEEEEc :Sec Str :======================= :RP:SCP|28->203|1eizA|8e-60|55.7|176/181|c.66.1.2 :================================ :BL:SWS|1->212|RRMJ_NITOC|e-121|100.0|212/212 :$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|31->201|PF01728|2e-26|39.2|171/179|FtsJ