[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA59139.1"

            "Transposase"
            ""

OrgPattern --------9113---1--------7457B5DG----1------------3112-12--1-2-122--- ---------------------1----------------21---1----------------------1-2------1----------1---------------------2---------------------------1----------36-331Bq------------17---------------4------26--1-1152-----122------1-1U7---1-------1------------------------------6-----1--1---------------------------------------------------1----------1-1---11-----2--1--------1--------------------------------------------------------1-------------------------------------------------------------------------------------------------------------1-----------------71----------------------1----1------------------------------------------------------------1----1---------1------------15-------------3--12211---32-22142-13132-2111111-------B---1-------1-11-21111223-----------------------------------------1--54---------1-4-----------------------------------------------------------------------------------------------------------5-312--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKTTLQIKLLPDGTQHSALKETMRVFNDACNAIAEVAFREQCASKFELQKLVYADVRKQF:Sequence : :Sec Str : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->90|PF04840|6e-04|30.3|76/313|Vps16_C 61: . . . * . .: 120 :GLSAQLTIRAIAKVVEAYKRDKSKQCFFKPTGAVVYDQRILSFKGLDRASLVTMQGRVSI:Sequence : EEEEEEEEccTTTcccEE EEEEEEc cccccEEE:Sec Str :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|15->90|PF04840|6e-04|30.3|76/313|Vps16_C 121: . . + . . .: 180 :PIQMGQYQRVQWHRAKGQADLVLVKGAFFLLVVIDTPEAPPIDPSGFIGIDLGITKVATD:Sequence :E EEEccccccEEEEEcTTcccEEcEEEEEccTTccEEEEEEEcTTccHHHHHHHHHHHH:Sec Str : ===================================:BL:SWS|146->332|YDCM_ECOLI|1e-15|29.5|183/402 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|146->243|PF01385|3e-06|30.6|98/207|Transposase_2 181: . * . . . .: 240 :SDGGSFCGSTVERVRQRYHRLRRRLQSKGTRSAKRHLKKIRRKEAQFRRSQNHIISKRLV:Sequence :ccc :Sec Str : XXXXXXXXXXXX :SEG|193->204|rvrqryhrlrrr :============================================================:BL:SWS|146->332|YDCM_ECOLI|1e-15|29.5|183/402 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|146->243|PF01385|3e-06|30.6|98/207|Transposase_2 241: + . . . . *: 300 :EKAKDTGRGIALEELKHIRSRTTVRKSDRAKHSGWSFFQLQSFIEYKAKLAGVFVQYIDP:Sequence : :Sec Str : =================:RP:SCP|284->332|1wj0A|2e-12|14.3|49/58|g.72.1.1 :============================================================:BL:SWS|146->332|YDCM_ECOLI|1e-15|29.5|183/402 :$$$ :RP:PFM|146->243|PF01385|3e-06|30.6|98/207|Transposase_2 : $$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|277->330|PF07282|9e-11|44.4|54/70|Transposase_35 301: . . . . + .: 360 :WYTSRTCSACGHADKANRKTQSHFQCVSCGYTDNADINAAINIAARADVMQPMVMRATTA:Sequence : :Sec Str : XXXXXXXXXXXXXXXX :SEG|333->348|dnadinaainiaarad :================================ :RP:SCP|284->332|1wj0A|2e-12|14.3|49/58|g.72.1.1 :================================ :BL:SWS|146->332|YDCM_ECOLI|1e-15|29.5|183/402 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|277->330|PF07282|9e-11|44.4|54/70|Transposase_35 361: . . . * . .: 420 :KDSPSTATSLPL :Sequence : :Sec Str