[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "noce0:ABA59308.1"

            "Cell cycle protein, FtsW"
            ""

OrgPattern -------------------------------------------------------------------- 2232322222222222222-222222222222222223332333-1132222222112222232111434211111113333321222222221222--212222222131111111222111112122222222133344---322222222222222222211222222221122222-22211112223343343444554445544366424443335322555555331222222222222223222222322222222221122212222322111222212222222222222111111111111-22222222222443444444443433233333333323333224434322223333212222-222211111111111111111111111111111-111111111121111111111111112222222222222222222222222222222--------2222222222222222121222122222222222222222222222222222222222222222222222222222222222211111112222222222222222222222222222222222222212221-----121222222212112222222222222222222223222222322221-2122211-11122222222222222222-22322222222221222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222221111111112333222222332223322222222222221222222222221211122--------------------------2222111111221 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLNRFLSTRQAARGSVSQPDLYLLGAALALAGLGWVMVGSASLAIADGPRFLWRQGIFLL:Sequence : XXXXXXXXXXXX :SEG|23->34|llgaalalaglg : $$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|36->374|PF01098|6e-54|41.3|334/357|FTSW_RODA_SPOVE 61: . . . * . .: 120 :MGLAAAFVVWRIRLIFWERFGPVLLLFGLGLLLLVLMPGIGVEANGSRRWLAIGPISLQP:Sequence : XXXXXXXXXXXXXXXXXXXX :SEG|80->99|fgpvlllfglgllllvlmpg : ====================:BL:SWS|101->374|FTSW_BUCAI|5e-62|48.5|274/399 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|36->374|PF01098|6e-54|41.3|334/357|FTSW_RODA_SPOVE 121: . . + . . .: 180 :SELVKLFMVVYFSGYLVRRSYEVRTTVRGFFFPVGVLTLVGLLLLLEPDFGAVVILFATM:Sequence : XXXXXXXXXXXXXXXXXX :SEG|149->166|gfffpvgvltlvglllll :============================================================:BL:SWS|101->374|FTSW_BUCAI|5e-62|48.5|274/399 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|36->374|PF01098|6e-54|41.3|334/357|FTSW_RODA_SPOVE 181: . * . . . .: 240 :LGMLFLGGARLWYFVLLAAIGGVGLAALAWGSPYRMERLTSFLDPWSDPLDSGYQLTQAL:Sequence : XXXXXXXXXXXXXXXX :SEG|196->211|llaaiggvglaalawg :============================================================:BL:SWS|101->374|FTSW_BUCAI|5e-62|48.5|274/399 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|36->374|PF01098|6e-54|41.3|334/357|FTSW_RODA_SPOVE 241: + . . . . *: 300 :IAFGRGEWFGVGLGNSIQKLFYLPEAHTDFLYAVLAEELGLVGSLAVIALFTVLVYRALL:Sequence :============================================================:BL:SWS|101->374|FTSW_BUCAI|5e-62|48.5|274/399 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|36->374|PF01098|6e-54|41.3|334/357|FTSW_RODA_SPOVE 301: . . . . + .: 360 :IGRAAERAGRVFGAYLAYGLGIWIGLQAFINLGVNMGVLPTKGLTLPLMSAGGSSIIVTC:Sequence : ######################### :PROS|331->355|PS00428|FTSW_RODA_SPOVE|PDOC00352| :============================================================:BL:SWS|101->374|FTSW_BUCAI|5e-62|48.5|274/399 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|36->374|PF01098|6e-54|41.3|334/357|FTSW_RODA_SPOVE 361: . . . * . .: 420 :IAVALILRVDLETRFPKTARRGIK :Sequence :============== :BL:SWS|101->374|FTSW_BUCAI|5e-62|48.5|274/399 :$$$$$$$$$$$$$$ :RP:PFM|36->374|PF01098|6e-54|41.3|334/357|FTSW_RODA_SPOVE