[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABA59308.1 noce0 ABA59308.1 "Cell cycle protein, FtsW"
MLNRFLSTRQAARGSVSQPDLYLLGAALALAGLGWVMVGSASLAIADGPRFLWRQGIFLL
MGLAAAFVVWRIRLIFWERFGPVLLLFGLGLLLLVLMPGIGVEANGSRRWLAIGPISLQP
SELVKLFMVVYFSGYLVRRSYEVRTTVRGFFFPVGVLTLVGLLLLLEPDFGAVVILFATM
LGMLFLGGARLWYFVLLAAIGGVGLAALAWGSPYRMERLTSFLDPWSDPLDSGYQLTQAL
IAFGRGEWFGVGLGNSIQKLFYLPEAHTDFLYAVLAEELGLVGSLAVIALFTVLVYRALL
IGRAAERAGRVFGAYLAYGLGIWIGLQAFINLGVNMGVLPTKGLTLPLMSAGGSSIIVTC
IAVALILRVDLETRFPKTARRGIK
//